Team:NCTU Formosa/biobricks
From 2014.igem.org
Parts Submitted to The Registry
<groupparts>iGEM014 NCTU_Formosa</groupparts>
Brief Information
Please click on the name of the parts for detailed information that is hosted in the Registry website. Team:NCTU Formosa/file/test
PBAN-Producted System
PBAN Bombyx mori 1 (BBa_K1415001)
Peptide Sequence: LSEDMPATPADQEMYQPDPEEMESRTRYFSPRL
PBAN(BM)+pSB1C3 This biobrick is the PBAN of Bombyx mori on the pSB1C3 backbone.
PBAN Bombyx mori 2
Pcons(J23101) + RBS(B0034) + PBAN(BM) This biobrick can produce Bombyx mori’s PBAN. As Bombyx mori’s PBAN is ingested by the female Bombyx mori, the female Bombyx mori will produce its own sex pheromone and attract the male Bombyx mori.
PBAN Bombyx mori 3
Pcons(J23101) + RBS(B0034) + PBAN(BM) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick produces Bombyx mori’s PBAN or not. If our biobrick works, it would be shown through the expression of the BFP gene and the emission of blue fluorescent light.
PBAN Mamestra brassicae 1
Peptide Sequence: LADDMPATPADQEMYRPDPEQIDSRTKYFSPRL
PBAN(MB)+pSB1C3 This biobrick is the PBAN of Mamestra brassicae on the pSB1C3 backbone.
PBAN Mamestra brassicae 2
Pcons(J23101) + RBS(B0034) + PBAN(MB) This biobrick can produce Mamestra brassicae’s PBAN. As Mamestra brassicae’s PBAN is ingested by the female Mamestra brassicae, the female Mamestra brassicae will produce its own sex pheromone and attract the male Mamestra brassicae.
PBAN Mamestra brassicae 3
Pcons(J23101) + RBS(B0034) + PBAN(MB) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick produces Mamestra brassicae’s PBAN or not. If our biobrick works, it would be shown through the expression of the BFP gene and the emission of blue fluorescent light.
PBAN Agrotis ipsilon 1
Peptide Sequence: LADDTPATPADQEMYRPDPEQIDSRTKYFSPRL
PBAN(AI)+pSB1C3 This biobrick is the PBAN of Agrotis ipsilon on the pSB1C3 backbone.
PBAN Agrotis ipsilon 2
Pcons(J23101) + RBS(B0034) + PBAN(AI) This biobrick can produce Agrotis ipsilon’s PBAN. As Agrotis ipsilon’s PBAN is ingested by the female Agrotis ipsilon, the female Agrotis ipsilon will produce its own sex pheromone and attract the male Agrotis ipsilon.
PBAN Agrotis ipsilon 3
Pcons(J23101) + RBS(B0034) + PBAN(AI) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick produces Agrotis ipsilon’s PBAN or not. If our biobrick works, it would be shown through the expression of the BFP gene and the emission of blue fluorescent light.
PBAN Lymantria dispar 1
Peptide Sequence: LADDMPATMADQEVYRPEPEQIDSRNKUFSPRL
PBAN(AI)+pSB1C3 This biobrick is the PBAN of Lymantria dispar on the pSB1C3 backbone.
PBAN Lymantria dispar 2
Pcons(J23101) + RBS(B0034) + PBAN(LD) This biobrick can produce Lymantria dispar’s PBAN. As Lymantria dispar’s PBAN is ingested by the female Lymantria dispar, the female Lymantria dispar will produce its own sex pheromone and attract the male Lymantria dispar.
PBAN Lymantria dispar 3
Pcons(J23101) + RBS(B0034) + PBAN(LD) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick produces Lymantria dispar’s PBAN or not. If our biobrick works, it would be shown through the expression of the BFP gene and the emission of blue fluorescent light.
PBAN Spodoptera litura 1
Peptide Sequence: LADDMPATPADQELYRPDPDQIDSRTKUFSPRL
PBAN(SL)+pSB1C3 This biobrick is the PBAN of Spodoptera litura on the pSB1C3 backbone.
PBAN Spodoptera litura 2
Pcons(J23101) + RBS(B0034) + PBAN(SL) This biobrick can produce Spodoptera litura’s PBAN. As Spodoptera litura’s PBAN is ingested by the female Spodoptera litura, the female Spodoptera litura will produce its own sex pheromone and attract the male Spodoptera litura.
PBAN Spodoptera litura 3
Pcons(J23101) + RBS(B0034) + PBAN(SL) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick produces Spodoptera litura’s PBAN or not. If our biobrick works, it would be shown through the expression of the BFP gene and the emission of blue fluorescent light.
PBAN Helicoverpa armigera Hubner 1
Peptide Sequence: LSDDMPARPADQEMYRQDPEQIDSRTKYFSPRL
PBAN(HAH)+pSB1C3 This biobrick is the PBAN of Helicoverpa armigera Hubner on the pSB1C3 backbone.
PBAN Helicoverpa armigera Hubner 2
Pcons(J23101) + RBS(B0034) + PBAN(HAH) This biobrick can produce Helicoverpa armigera Hubner’s PBAN. As Helicoverpa armigera Hubner’s PBAN is ingested by the female Helicoverpa armigera Hubner, the female Helicoverpa armigera Hubner will produce its own sex pheromone and attract the male Helicoverpa armigera Hubner.
PBAN Helicoverpa armigera Hubner 3
Pcons(J23101) + RBS(B0034) + PBAN(HAH) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick produces Helicoverpa armigera Hubner’s PBAN or not. If our biobrick works, it would be shown through the expression of the BFP gene and the emission of blue fluorescent light.
PBAN Adoxophyes sp. 1
Peptide Sequence: QSEAVTSSDEQVYRQDMSPVDGRLKYFSPRL
PBAN(AS)+pSB1C3 This biobrick is the PBAN of Adoxophyes sp. on the pSB1C3 backbone.
PBAN Adoxophyes sp. 2
Pcons(J23101) + RBS(B0034) + PBAN(AS) This biobrick can produce Adoxophyes sp.’s PBAN. As Adoxophyes sp.’s PBAN is ingested by the female Adoxophyes sp., the female Adoxophyes sp. will produce its own sex pheromone and attract the male Adoxophyes sp.
PBAN Adoxophyes sp. 3
Pcons(J23101) + RBS(B0034) + PBAN(AS) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick produces Adoxophyes sp.’s PBAN or not. If our biobrick works, it would be shown through the expression of the BFP gene and the emission of blue fluorescent light.
PBAN Solenopsis invicta 1
Peptide Sequence: GSGEDLSYGDAYEVDEDDHPLFVPR
PBAN(SI)+pSB1C3 This biobrick is the PBAN of Solenopsis invicta on the pSB1C3 backbone.
PBAN Solenopsis invicta 2
Pcons(J23101) + RBS(B0034) + PBAN(SI) This biobrick can produce Solenopsis invicta’s PBAN. As Solenopsis invicta’s PBAN is ingested by the female Solenopsis invicta, the female Solenopsis invicta will produce its own sex pheromone and attract the male Solenopsis invicta.
PBAN Solenopsis invicta 3
Pcons(J23101) + RBS(B0034) + PBAN(SI) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick produces Solenopsis invicta’s PBAN or not. If our biobrick works, it would be shown through the expression of the BFP gene and the emission of blue fluorescent light.
PBAN Aedes aegypti 1
Peptide Sequence: DASSSNENNSRPPFAPRL
PBAN(AA)+pSB1C3 This biobrick is the PBAN of Aedes aegypti on the pSB1C3 backbone.
PBAN Aedes aegypti 2
Pcons(J23101) + RBS(B0034) + PBAN(AA) This biobrick can produce Aedes aegypti’s PBAN. As Aedes aegypti’s PBAN is ingested by the female Aedes aegypti, the female Aedes aegypti will produce its own sex pheromone and attract the male Aedes aegypti.
PBAN Aedes aegypti 3
Pcons(J23101) + RBS(B0034) + PBAN(AA) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick produces Aedes aegypti’s PBAN or not. If our biobrick works, it would be shown through the expression of the BFP gene and the emission of blue fluorescent light.