"
Team:NCTU Formosa/biobrickss
From 2014.igem.org
Parts submitted to the Registry
<groupparts>iGEM014 NCTU_Formosa</groupparts>
Brief Information
Please click on the name of the parts for detailed information that is hosted in the Registry website. Team:NCTU Formosa/file/test
PBAN-producted system
PBAN Bombyx mori 1
Peptide Sequence： LSEDMPATPADQEMYQPDPEEMESRTRYFSPRL
PBAN(BM)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.
PBAN Bombyx mori 2
Pcons(J23101) + RBS(B0034) + PBAN(BM) This biobrick produces Bombyx mori’s PBAN.
PBAN Bombyx mori 3
Pcons(J23101) + RBS(B0034) + PBAN(BM) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.
PBAN Mamestra brassicae 1
Peptide Sequence： LADDMPATPADQEMYRPDPEQIDSRTKYFSPRL
PBAN(MB)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.
PBAN Mamestra brassicae 2
Pcons(J23101) + RBS(B0034) + PBAN(MB) This biobrick produces Mamestra brassicae’s PBAN.
PBAN Mamestra brassicae 3
Pcons(J23101) + RBS(B0034) + PBAN(MB) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.
PBAN Agrotis ipsilon 1
Peptide Sequence： LADDTPATPADQEMYRPDPEQIDSRTKYFSPRL
PBAN(AI)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.
PBAN Agrotis ipsilon 2
Pcons(J23101) + RBS(B0034) + PBAN(AI) This biobrick produces Agrotis ipsilon’s PBAN.
PBAN Agrotis ipsilon 3
Pcons(J23101) + RBS(B0034) + PBAN(AI) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.
PBAN Lymantria dispar 1
Peptide Sequence： LADDMPATMADQEVYRPEPEQIDSRNKUFSPRL
PBAN(AI)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.
PBAN Lymantria dispar 2
Pcons(J23101) + RBS(B0034) + PBAN(LD) This biobrick produces Lymantria dispar’s PBAN.
PBAN Lymantria dispar 3
Pcons(J23101) + RBS(B0034) + PBAN(LD) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.
PBAN Spodoptera litura 1
Peptide Sequence： LADDMPATPADQELYRPDPDQIDSRTKUFSPRL
PBAN(SL)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.
PBAN Spodoptera litura 2
Pcons(J23101) + RBS(B0034) + PBAN(SL) This biobrick produces Spodoptera litura’s PBAN.
PBAN Spodoptera litura 3
Pcons(J23101) + RBS(B0034) + PBAN(SL) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.
PBAN Helicoverpa armigera Hubner 1
Peptide Sequence： LSDDMPARPADQEMYRQDPEQIDSRTKYFSPRL
PBAN(HAH)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.
PBAN Helicoverpa armigera Hubner 2
Pcons(J23101) + RBS(B0034) + PBAN(HAH) This biobrick produces Helicoverpa armigera Hubner’s PBAN.
PBAN Helicoverpa armigera Hubner 3
Pcons(J23101) + RBS(B0034) + PBAN(HAH) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.
PBAN Adoxophyes sp. 1
Peptide Sequence： QSEAVTSSDEQVYRQDMSPVDGRLKYFSPRL
PBAN(AS)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.
PBAN Adoxophyes sp. 2
Pcons(J23101) + RBS(B0034) + PBAN(AS) This biobrick produces Adoxophyes sp’s PBAN.
PBAN Adoxophyes sp. 3
Pcons(J23101) + RBS(B0034) + PBAN(AS) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.
PBAN Solenopsis invicta 1
Peptide Sequence： GSGEDLSYGDAYEVDEDDHPLFVPR
PBAN(SI)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.
PBAN Solenopsis invicta 2
Pcons(J23101) + RBS(B0034) + PBAN(SI) This biobrick produces Solenopsis invicta’s PBAN.
PBAN Solenopsis invicta 3
Pcons(J23101) + RBS(B0034) + PBAN(SI) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.
PBAN Aedes aegypti 1
Peptide Sequence： DASSSNENNSRPPFAPRL
PBAN(AA)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.
PBAN Aedes aegypti 2
Pcons(J23101) + RBS(B0034) + PBAN(AA) This biobrick produces Aedes aegypti’s PBAN.
PBAN Aedes aegypti 3
Pcons(J23101) + RBS(B0034) + PBAN(AA) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.
