Team:NCTU Formosa/biobricks

Parts submitted to the Registry

<groupparts>iGEM014 NCTU_Formosa</groupparts>

Brief Information

Please click on the name of the parts for detailed information that is hosted in the Registry website. Team:NCTU Formosa/file/test

PBAN-producted system

PBAN Bombyx mori 1

Peptide Sequence： LSEDMPATPADQEMYQPDPEEMESRTRYFSPRL

PBAN(BM)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.

PBAN Bombyx mori 2

Pcons(J23101) + RBS(B0034) + PBAN(BM) This biobrick helps us produce Bombyx mori’s PBAN. As Bombyx mori’s PBAN is ingested by the female Bombyx mori, the female Bombyx mori will produce its own sex pheromone and attract male Bombyx mori.

PBAN Bombyx mori 3

Pcons(J23101) + RBS(B0034) + PBAN(BM) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.

PBAN Mamestra brassicae 1

Peptide Sequence： LADDMPATPADQEMYRPDPEQIDSRTKYFSPRL

PBAN(MB)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.

PBAN Mamestra brassicae 2

Pcons(J23101) + RBS(B0034) + PBAN(MB) This biobrick produces Mamestra brassicae’s PBAN.

PBAN Mamestra brassicae 3

Pcons(J23101) + RBS(B0034) + PBAN(MB) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.

PBAN Agrotis ipsilon 1

Peptide Sequence： LADDTPATPADQEMYRPDPEQIDSRTKYFSPRL

PBAN(AI)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.

PBAN Agrotis ipsilon 2

Pcons(J23101) + RBS(B0034) + PBAN(AI) This biobrick produces Agrotis ipsilon’s PBAN.

PBAN Agrotis ipsilon 3

Pcons(J23101) + RBS(B0034) + PBAN(AI) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.

PBAN Lymantria dispar 1

Peptide Sequence： LADDMPATMADQEVYRPEPEQIDSRNKUFSPRL

PBAN(AI)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.

PBAN Lymantria dispar 2

Pcons(J23101) + RBS(B0034) + PBAN(LD) This biobrick produces Lymantria dispar’s PBAN.

PBAN Lymantria dispar 3

Pcons(J23101) + RBS(B0034) + PBAN(LD) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.

PBAN Spodoptera litura 1

Peptide Sequence： LADDMPATPADQELYRPDPDQIDSRTKUFSPRL

PBAN(SL)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.

PBAN Spodoptera litura 2

Pcons(J23101) + RBS(B0034) + PBAN(SL) This biobrick produces Spodoptera litura’s PBAN.

PBAN Spodoptera litura 3

Pcons(J23101) + RBS(B0034) + PBAN(SL) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.

PBAN Helicoverpa armigera Hubner 1

Peptide Sequence： LSDDMPARPADQEMYRQDPEQIDSRTKYFSPRL

PBAN(HAH)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.

PBAN Helicoverpa armigera Hubner 2

Pcons(J23101) + RBS(B0034) + PBAN(HAH) This biobrick produces Helicoverpa armigera Hubner’s PBAN.

PBAN Helicoverpa armigera Hubner 3

Pcons(J23101) + RBS(B0034) + PBAN(HAH) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.

PBAN Adoxophyes sp. 1

Peptide Sequence： QSEAVTSSDEQVYRQDMSPVDGRLKYFSPRL

PBAN(AS)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.

PBAN Adoxophyes sp. 2

Pcons(J23101) + RBS(B0034) + PBAN(AS) This biobrick produces Adoxophyes sp’s PBAN.

PBAN Adoxophyes sp. 3

Pcons(J23101) + RBS(B0034) + PBAN(AS) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.

PBAN Solenopsis invicta 1

Peptide Sequence： GSGEDLSYGDAYEVDEDDHPLFVPR

PBAN(SI)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.

PBAN Solenopsis invicta 2

Pcons(J23101) + RBS(B0034) + PBAN(SI) This biobrick produces Solenopsis invicta’s PBAN.

PBAN Solenopsis invicta 3

Pcons(J23101) + RBS(B0034) + PBAN(SI) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.

PBAN Aedes aegypti 1

Peptide Sequence： DASSSNENNSRPPFAPRL

PBAN(AA)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.

PBAN Aedes aegypti 2

Pcons(J23101) + RBS(B0034) + PBAN(AA) This biobrick produces Aedes aegypti’s PBAN.

PBAN Aedes aegypti 3

Pcons(J23101) + RBS(B0034) + PBAN(AA) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.