Team:NCTU Formosa/biobricks

Parts submitted to the Registry

<groupparts>iGEM014 NCTU_Formosa</groupparts>

Brief Information

Please click on the name of the parts for detailed information that is hosted in the Registry website.

PBAN-producted system

PBAN Bombyx mori

Peptide Sequence： LSEDMPATPADQEMYQPDPEEMESRTRYFSPRL

Introduction of Bombyx mori： Silkworm is not a kind of pest. This special creature can produce raw silk, which makes them take an important position in the history of human economic life and agricultural culture. It is easy to feed and to obtain.

PBAN Mamestra brassicae

Peptide Sequence： LADDMPATPADQEMYRPDPEQIDSRTKYFSPRL

Introduction of Mamestra brassicae：Mamestra brassicae can eat up over 100 species of vegetables such as cauliflower, cabbage, radish, rape, eggplant fruit, beans, melons, potatoes and so on.

PBAN Agrotis ipsilon

Peptide Sequence： LADDTPATPADQEMYRPDPEQIDSRTKYFSPRL

Introduction of Agrotis ipsilon：Agrotis ipsilon can harm hundreds of species of plants, so it is a harmful pest to agriculture. They harm larch, pine, ash, Manchurian walnut, pine, fir, mulberry, tea , Elaeagnus, fruit trees and many other seedlings.

PBAN Lymantria dispar

Peptide Sequence： LADDMPATMADQEVYRPEPEQIDSRNKUFSPRL

Introduction of Lymantria dispar：Lymantria dispar is one of the most destructive pests of fruit trees throughout the Northern Hemisphere. It is also a major pest to broad leaved forest. Larvae of Lymantria dispar can cause severe leaves loss, resulting in growth retardation and even trees’ death. Moreover, its larvae and eggs can cause some allergies.

PBAN Spodoptera litura

Peptide Sequence： LADDMPATPADQELYRPDPDQIDSRTKUFSPRL

Introduction of Spodoptera litura：Larvae are nocturnal, omnivorous.They can harm a variety of crops such as leafy vegetables, garland chrysanthemum, groundnuts, Sesbania, soybeans, red beans, green onions, corn, flowers, fruits and Indian jujube, papayas and other fruit trees and other crops; larvae eat great, they will chew on the leaves of plants, often resulting in serious problems.

PBAN6

• By using mGFP as a reporter gene, we can test whether the 37 °C RBS works.

PBAN7

• In our circuit, this biobrick is the part of P_lux's activation when the temperature reaches to 37^oC.

PBAN8

• The sRNA is the complement of its rRBS. It can regulate the downstream of rRBS in RNA level by binding onto the rRBS when it is transcribed in order to interrupt ribosomes' work. In addition, adding Plux upstream makes the sequence be controlled by luxR/AHL complex.
  

PBAN9

• The sRNA is the complement of its rRBS. It can regulate the downstream of rRBS in RNA level by binding onto the rRBS when it is transcribed in order to interrupt ribosomes' work.