Team:NCTU Formosa/biobricks

From 2014.igem.org

(Difference between revisions)
(→PBAN9)
Line 18: Line 18:
Peptide Sequence：
Peptide Sequence：
LSEDMPATPADQEMYQPDPEEMESRTRYFSPRL
LSEDMPATPADQEMYQPDPEEMESRTRYFSPRL
-
<P>Introduction of Bombyx mori：
+
<P>Pcons(J23101) + RBS(B0034) + PBAN(BM)
-
Silkworm is not a kind of pest. This special creature can produce raw silk, which makes them take an important position in the history of human economic life and agricultural culture. It is easy to feed and to obtain.</P>
+
This biobrick produces Bombyx mori’s PBAN.</P>
 +
 
 +
<P>RBS(B0034) + BFP(K592100) + Ter(J61048)
 +
This biobrick tests whether our biobrick work or not.
 +
If our biobrick works , it would glow blue light.</P>
 +
 
======PBAN Mamestra brassicae======
======PBAN Mamestra brassicae======
Line 25: Line 30:
LADDMPATPADQEMYRPDPEQIDSRTKYFSPRL
LADDMPATPADQEMYRPDPEQIDSRTKYFSPRL
-
<P>Introduction of Mamestra brassicae：Mamestra brassicae can eat up over 100 species of vegetables such as cauliflower, cabbage, radish, rape, eggplant fruit, beans, melons, potatoes and so on.</P>
+
<P>Pcons(J23101) + RBS(B0034) + PBAN(MB)
 +
This biobrick produces Mamestra brassicae’s PBAN.</P>
 +
 
 +
<P>RBS(B0034) + BFP(K592100) + Ter(J61048)
 +
This biobrick tests whether our biobrick work or not.
 +
If our biobrick works , it would glow blue light.</P>
 +
 
======PBAN Agrotis ipsilon======
======PBAN Agrotis ipsilon======
Line 31: Line 42:
LADDTPATPADQEMYRPDPEQIDSRTKYFSPRL
LADDTPATPADQEMYRPDPEQIDSRTKYFSPRL
-
<P>Introduction of Agrotis ipsilon：Agrotis ipsilon can harm hundreds of species of plants, so it is a harmful pest to agriculture. They harm larch, pine, ash, Manchurian walnut, pine, fir, mulberry, tea , Elaeagnus, fruit trees and many other seedlings.</P>
+
<P>Pcons(J23101) + RBS(B0034) + PBAN(AI)
 +
This biobrick produces Agrotis ipsilon’s PBAN.</P>
 +
 
 +
<P>RBS(B0034) + BFP(K592100) + Ter(J61048)
 +
This biobrick tests whether our biobrick work or not.
 +
If our biobrick works , it would glow blue light.</P>
 +
 
======PBAN Lymantria dispar======
======PBAN Lymantria dispar======
Peptide Sequence：
Peptide Sequence：
LADDMPATMADQEVYRPEPEQIDSRNKUFSPRL
LADDMPATMADQEVYRPEPEQIDSRNKUFSPRL
-
<P>Introduction of Lymantria dispar：Lymantria dispar is one of the most destructive pests of fruit trees throughout the Northern Hemisphere. It is also a major pest to broad leaved forest. Larvae of Lymantria dispar can cause severe leaves loss, resulting in growth retardation and even trees’ death. Moreover, its larvae and eggs can cause some allergies.</P>
+
<P>Pcons(J23101) + RBS(B0034) + PBAN(LD)
 +
This biobrick produces Lymantria dispar’s PBAN.</P>
 +
 
 +
<P>RBS(B0034) + BFP(K592100) + Ter(J61048)
 +
This biobrick tests whether our biobrick work or not.
 +
If our biobrick works , it would glow blue light.</P>
 +
 
======PBAN Spodoptera litura======
======PBAN Spodoptera litura======
Peptide Sequence：
Peptide Sequence：
LADDMPATPADQELYRPDPDQIDSRTKUFSPRL
LADDMPATPADQELYRPDPDQIDSRTKUFSPRL
-
<P>Introduction of Spodoptera litura：Larvae are nocturnal, omnivorous.They can harm a variety of crops such as leafy vegetables, garland chrysanthemum, groundnuts, Sesbania, soybeans, red beans, green onions, corn, flowers, fruits and Indian jujube, papayas and other fruit trees and other crops; larvae eat great, they will chew on the leaves of plants, often resulting in serious problems.</P>
+
<P>Pcons(J23101) + RBS(B0034) + PBAN(SL)
 +
This biobrick produces Spodoptera litura’s PBAN.</P>
 +
 
 +
<P>RBS(B0034) + BFP(K592100) + Ter(J61048)
 +
This biobrick tests whether our biobrick work or not.
 +
If our biobrick works , it would glow blue light.</P>
 +
 
======PBAN Helicoverpa armigera Hubner======
======PBAN Helicoverpa armigera Hubner======
Peptide Sequence：
Peptide Sequence：
LSDDMPARPADQEMYRQDPEQIDSRTKYFSPRL
LSDDMPARPADQEMYRQDPEQIDSRTKYFSPRL
-
<P>Introduction of Helicoverpa armigera Hubner：Helicoverpa armigera Hubner do harm to Cruciferous vegetables, yams, lobular Aquatica, sweet potatoes, taro, beans, celery, lilies, Roselle, okra, carrots, water spinach, asparagus, burdock, peanuts, tobacco, sorghum and cotton.</P>
+
<P>Pcons(J23101) + RBS(B0034) + PBAN(HAH)
 +
This biobrick produces Helicoverpa armigera Hubner’s PBAN.</P>
 +
 
 +
<P>RBS(B0034) + BFP(K592100) + Ter(J61048)
 +
This biobrick tests whether our biobrick work or not.
 +
If our biobrick works , it would glow blue light.
 +
</P>
======PBAN Adoxophyes sp.======
======PBAN Adoxophyes sp.======
Peptide Sequence：
Peptide Sequence：
QSEAVTSSDEQVYRQDMSPVDGRLKYFSPRL
QSEAVTSSDEQVYRQDMSPVDGRLKYFSPRL
-
<P>Introduction of Adoxophyes sp.：Adoxophyes is a common pest in Taiwan, which often do harm to some fruit trees such as longan and litchi. Some Adoxophyes, however, damage tea trees.</P>
+
<P>Pcons(J23101) + RBS(B0034) + PBAN(AS)
 +
This biobrick produces Adoxophyes sp’s PBAN.</P>
 +
 
 +
<P>RBS(B0034) + BFP(K592100) + Ter(J61048)
 +
This biobrick tests whether our biobrick work or not.
 +
If our biobrick works , it would glow blue light.</P>
 +
 
======PBAN Solenopsis invicta======
======PBAN Solenopsis invicta======
Peptide Sequence：
Peptide Sequence：
GSGEDLSYGDAYEVDEDDHPLFVPR
GSGEDLSYGDAYEVDEDDHPLFVPR
-
<P>Introduction of Solenopsis invicta：Solenopsis invicta is omnivorous . They cause damage of the animal habitats because they take a strong competitive advantage in ecology . They prey many invertebrates and also eat crops seeds, fruits, shoots,tender stems and roots, affecting growth and harvest of crops thus cause great economic losses.</P>
+
<P>Pcons(J23101) + RBS(B0034) + PBAN(SI)
 +
This biobrick produces Solenopsis invicta’s PBAN.</P>
 +
 
 +
<P>RBS(B0034) + BFP(K592100) + Ter(J61048)
 +
This biobrick tests whether our biobrick work or not.
 +
If our biobrick works , it would glow blue light.</P>
 +
 
======PBAN Aedes aegypti======
======PBAN Aedes aegypti======
Peptide Sequence：
Peptide Sequence：
DASSSNENNSRPPFAPRL
DASSSNENNSRPPFAPRL
-
<P>Introduction of Aedes aegypti：Aegypti’s eggs, larvae and pupae is mainly discovered in artificial water containers, such as storage tanks, water tanks, tires, buckets, flower vases, potted water dish, magnetic pots, bottles and water in the basement, etc. And they are the disease vectors to the Dengue Fever.</P>
+
<P>Pcons(J23101) + RBS(B0034) + PBAN(AA)
 +
This biobrick produces Aedes aegypti’s PBAN.</P>
 +
 
 +
<P>RBS(B0034) + BFP(K592100) + Ter(J61048)
 +
This biobrick tests whether our biobrick work or not.
 +
If our biobrick works , it would glow blue light.</P>
  </div>
  </div>

Revision as of 08:57, 23 September 2014

Project

Parts submitted to the Registry

<groupparts>iGEM014 NCTU_Formosa</groupparts>

Brief Information

Please click on the name of the parts for detailed information that is hosted in the Registry website.

PBAN-producted system

PBAN Bombyx mori

Peptide Sequence： LSEDMPATPADQEMYQPDPEEMESRTRYFSPRL

Pcons(J23101) + RBS(B0034) + PBAN(BM) This biobrick produces Bombyx mori’s PBAN.

RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works , it would glow blue light.


PBAN Mamestra brassicae

Peptide Sequence： LADDMPATPADQEMYRPDPEQIDSRTKYFSPRL

Pcons(J23101) + RBS(B0034) + PBAN(MB) This biobrick produces Mamestra brassicae’s PBAN.

RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works , it would glow blue light.


PBAN Agrotis ipsilon

Peptide Sequence： LADDTPATPADQEMYRPDPEQIDSRTKYFSPRL

Pcons(J23101) + RBS(B0034) + PBAN(AI) This biobrick produces Agrotis ipsilon’s PBAN.

RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works , it would glow blue light.


PBAN Lymantria dispar

Peptide Sequence： LADDMPATMADQEVYRPEPEQIDSRNKUFSPRL

Pcons(J23101) + RBS(B0034) + PBAN(LD) This biobrick produces Lymantria dispar’s PBAN.

RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works , it would glow blue light.


PBAN Spodoptera litura

Peptide Sequence： LADDMPATPADQELYRPDPDQIDSRTKUFSPRL

Pcons(J23101) + RBS(B0034) + PBAN(SL) This biobrick produces Spodoptera litura’s PBAN.

RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works , it would glow blue light.


PBAN Helicoverpa armigera Hubner

Peptide Sequence： LSDDMPARPADQEMYRQDPEQIDSRTKYFSPRL

Pcons(J23101) + RBS(B0034) + PBAN(HAH) This biobrick produces Helicoverpa armigera Hubner’s PBAN.

RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works , it would glow blue light.

PBAN Adoxophyes sp.

Peptide Sequence： QSEAVTSSDEQVYRQDMSPVDGRLKYFSPRL

Pcons(J23101) + RBS(B0034) + PBAN(AS) This biobrick produces Adoxophyes sp’s PBAN.

RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works , it would glow blue light.


PBAN Solenopsis invicta

Peptide Sequence： GSGEDLSYGDAYEVDEDDHPLFVPR

Pcons(J23101) + RBS(B0034) + PBAN(SI) This biobrick produces Solenopsis invicta’s PBAN.

RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works , it would glow blue light.


PBAN Aedes aegypti

Peptide Sequence： DASSSNENNSRPPFAPRL

Pcons(J23101) + RBS(B0034) + PBAN(AA) This biobrick produces Aedes aegypti’s PBAN.

RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works , it would glow blue light.

Retrieved from "http://2014.igem.org/Team:NCTU_Formosa/biobricks"