Team:NCTU Formosa/biobricks

Parts submitted to the Registry

<groupparts>iGEM014 NCTU_Formosa</groupparts>

Brief Information

Please click on the name of the parts for detailed information that is hosted in the Registry website.

PBAN-producted system

Introduction of Bombyx mori： Silkworm is not a kind of pest. This special creature can produce raw silk, which makes them take an important position in the history of human economic life and agricultural culture. It is easy to feed and to obtain. Peptide Sequence： LSEDMPATPADQEMYQPDPEEMESRTRYFSPRL

PBAN2

• Cph8 is a chimeric light receptor. It is a fusion of the photoreceptor cph1 and the envZ histidine kinase. cph1 is only active when it binds the chromophore phycocyanobiline (PCB).

PBAN3

• This is the key part to change Ompc promoter intro red promotor. The lacI will inhibit the function of P_lac, thus, the original outcomes will be converted into our expected result.

PBAN4

• Ompc promtor, which can sense red light with the presence of cph8. It will be turned on in the dark ,and be turned off in the bright. For the convenient use, we add lacI and lac promotor downstream the biobrick. This part, so called red promotor, can be activated under red light, and inactive in the dark.

PBAN5

PBAN6

• By using mGFP as a reporter gene, we can test whether the 37 °C RBS works.

PBAN7

• In our circuit, this biobrick is the part of P_lux's activation when the temperature reaches to 37^oC.

PBAN8

• The sRNA is the complement of its rRBS. It can regulate the downstream of rRBS in RNA level by binding onto the rRBS when it is transcribed in order to interrupt ribosomes' work. In addition, adding Plux upstream makes the sequence be controlled by luxR/AHL complex.
  

PBAN9

• The sRNA is the complement of its rRBS. It can regulate the downstream of rRBS in RNA level by binding onto the rRBS when it is transcribed in order to interrupt ribosomes' work.

</div>
</div>