Team:NCTU Formosa/biobricks
From 2014.igem.org
(→PBAN Helicoverpa armigera Hubner 2 (BBa_K1415106)) |
(→PBAN Helicoverpa armigera Hubner 3 (BBa_K1415206)) |
||
Line 120: | Line 120: | ||
[[File:ALLHAH.png|780px|link=|frameless|left]] | [[File:ALLHAH.png|780px|link=|frameless|left]] | ||
<P>Pcons(J23101) + RBS(B0034) + PBAN(HAH) + RBS(B0034) + BFP(K592100) + Ter(J61048) | <P>Pcons(J23101) + RBS(B0034) + PBAN(HAH) + RBS(B0034) + BFP(K592100) + Ter(J61048) | ||
- | + | The above circuit is constructed mainly to test whether it produces ''Helicoverpa armigera Hubner'' PBAN. | |
- | If | + | If the circuit do work, it would result in the expression of the BFP gene and the emission of blue fluorescent light. |
</P> | </P> | ||
Revision as of 15:39, 16 October 2014
Parts Submitted to The Registry
Please click on the name of the parts for detailed information that is hosted in the Registry website. <groupparts>iGEM014 NCTU_Formosa</groupparts>
Brief Information
PBAN Production
PBAN Bombyx mori 1 (BBa_K1415001)
Peptide Sequence: LSEDMPATPADQEMYQPDPEEMESRTRYFSPRL
PBAN(BM)+pSB1C3 This biobrick is the PBAN of Bombyx mori on the pSB1C3 backbone.
PBAN Bombyx mori 2 (BBa_K1415101)
Pcons(J23101) + RBS(B0034) + PBAN(BM) This circuit is responsible for producing the Bombyx mori’s PBAN. As Bombyx mori PBAN is ingested by the female Bombyx mori, the female Bombyx mori will produce its own sex pheromone and attract the male Bombyx mori.
PBAN Bombyx mori 3 (BBa_K1415201)
Pcons(J23101) + RBS(B0034) + PBAN(BM) + RBS(B0034) + BFP(K592100) + Ter(J61048) The above circuit is constructed mainly to test whether it produces Bombyx mori’s PBAN. If the circuit do work, it would result in the expression of the BFP gene and emission of blue fluorescent light.
PBAN Mamestra brassicae 1 (BBa_K1415002)
Peptide Sequence: LADDMPATPADQEMYRPDPEQIDSRTKYFSPRL
PBAN(MB)+pSB1C3 This biobrick is the PBAN of Mamestra brassicae on the pSB1C3 backbone.
PBAN Mamestra brassicae 2 (BBa_K1415102)
Pcons(J23101) + RBS(B0034) + PBAN(MB) This circuit is responsible for producing the Mamestra brassicae PBAN. As Mamestra brassicae PBAN is ingested by the female Mamestra brassicae, the female Mamestra brassicae will produce its own sex pheromone and attract male Mamestra brassicaes.
PBAN Mamestra brassicae 3 (BBa_K1415202)
Pcons(J23101) + RBS(B0034) + PBAN(MB) + RBS(B0034) + BFP(K592100) + Ter(J61048) The above circuit is constructed mainly to test whether it produces Mamestra brassicae’s PBAN. If the circuit do work, it would result in the expression of the BFP gene and emission of blue fluorescent light.
PBAN Agrotis ipsilon 1 (BBa_K1415003)
Peptide Sequence: LADDTPATPADQEMYRPDPEQIDSRTKYFSPRL
PBAN(AI)+pSB1C3 This biobrick is the PBAN of Agrotis ipsilon on the pSB1C3 backbone.
PBAN Agrotis ipsilon 2 (BBa_K1415103)
Pcons(J23101) + RBS(B0034) + PBAN(AI) This circuit is responsible for producing the Agrotis ipsilon PBAN. As Agrotis ipsilon PBAN is ingested by the female Agrotis ipsilon, the female Agrotis ipsilon will produce its own sex pheromone and attract male Agrotis ipsilons.
PBAN Agrotis ipsilon 3 (BBa_K1415203)
Pcons(J23101) + RBS(B0034) + PBAN(AI) + RBS(B0034) + BFP(K592100) + Ter(J61048) The above circuit is constructed mainly to test whether it produces Agrotis ipsilon’s PBAN. If the circuit do work, it would result in the expression of the BFP gene and emission of blue fluorescent light.
PBAN Lymantria dispar 1 (BBa_K1415004)
Peptide Sequence: LADDMPATMADQEVYRPEPEQIDSRNKUFSPRL
PBAN(AI)+pSB1C3 This biobrick is the PBAN of Lymantria dispar on the pSB1C3 backbone.
PBAN Lymantria dispar 2 (BBa_K1415104)
Pcons(J23101) + RBS(B0034) + PBAN(LD) This circuit is responsible for producing Lymantria dispar’s PBAN. As Lymantria dispar PBAN is ingested by the female Lymantria dispar, the female Lymantria dispar will produce its own sex pheromone and attract male Lymantria dispars.
PBAN Lymantria dispar 3 (BBa_K1415204)
Pcons(J23101) + RBS(B0034) + PBAN(LD) + RBS(B0034) + BFP(K592100) + Ter(J61048) The above circuit is constructed mainly to test whether it produces Lymantria dispar’s PBAN. If the circuit do work, it would result in the expression of the BFP gene and the emission of blue fluorescent light.
PBAN Spodoptera litura 1 (BBa_K1415005)
Peptide Sequence: LADDMPATPADQELYRPDPDQIDSRTKUFSPRL
PBAN(SL)+pSB1C3 This biobrick is the PBAN of Spodoptera litura on the pSB1C3 backbone.
PBAN Spodoptera litura 2 (BBa_K1415105)
Pcons(J23101) + RBS(B0034) + PBAN(SL) This circuit is responsible for producing the Spodoptera litura PBAN. As Spodoptera litura PBAN is ingested by the female Spodoptera litura, the female Spodoptera litura will produce its own sex pheromone and attract male Spodoptera lituras.
PBAN Spodoptera litura 3 (BBa_K1415205)
Pcons(J23101) + RBS(B0034) + PBAN(SL) + RBS(B0034) + BFP(K592100) + Ter(J61048) The above circuit is constructed mainly to test whether it produces Spodoptera litura’s PBAN. If the circuit do work, it would result in the expression of the BFP gene and the emission of blue fluorescent light.
PBAN Helicoverpa armigera Hubner 1 (BBa_K1415006)
Peptide Sequence: LSDDMPARPADQEMYRQDPEQIDSRTKYFSPRL
PBAN(HAH)+pSB1C3 This biobrick is the PBAN of Helicoverpa armigera Hubner on the pSB1C3 backbone.
PBAN Helicoverpa armigera Hubner 2 (BBa_K1415106)
Pcons(J23101) + RBS(B0034) + PBAN(HAH) This circuit is responsible for producing the Helicoverpa armigera Hubner PBAN. As Helicoverpa armigera Hubner PBAN is ingested by the female Helicoverpa armigera Hubner, the female Helicoverpa armigera Hubner will produce its own sex pheromone and attract male Helicoverpa armigera Hubners.
PBAN Helicoverpa armigera Hubner 3 (BBa_K1415206)
Pcons(J23101) + RBS(B0034) + PBAN(HAH) + RBS(B0034) + BFP(K592100) + Ter(J61048) The above circuit is constructed mainly to test whether it produces Helicoverpa armigera Hubner PBAN. If the circuit do work, it would result in the expression of the BFP gene and the emission of blue fluorescent light.
PBAN Adoxophyes sp. 1 (BBa_K1415007)
Peptide Sequence: QSEAVTSSDEQVYRQDMSPVDGRLKYFSPRL
PBAN(AS)+pSB1C3 This biobrick is the PBAN of Adoxophyes sp. on the pSB1C3 backbone.
PBAN Adoxophyes sp. 2 (BBa_K1415107)
Pcons(J23101) + RBS(B0034) + PBAN(AS) This biobrick can produce Adoxophyes sp.’s PBAN. As Adoxophyes sp.’s PBAN is ingested by the female Adoxophyes sp., the female Adoxophyes sp. will produce its own sex pheromone and attract the male Adoxophyes sp.
PBAN Adoxophyes sp. 3 (BBa_K1415207)
Pcons(J23101) + RBS(B0034) + PBAN(AS) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick produces Adoxophyes sp.’s PBAN or not. If our biobrick works, it would be shown through the expression of the BFP gene and the emission of blue fluorescent light.
PBAN Solenopsis invicta 1 (BBa_K1415008)
Peptide Sequence: GSGEDLSYGDAYEVDEDDHPLFVPR
PBAN(SI)+pSB1C3 This biobrick is the PBAN of Solenopsis invicta on the pSB1C3 backbone.
PBAN Solenopsis invicta 2 (BBa_K1415108)
Pcons(J23101) + RBS(B0034) + PBAN(SI) This biobrick can produce Solenopsis invicta’s PBAN. As Solenopsis invicta’s PBAN is ingested by the female Solenopsis invicta, the female Solenopsis invicta will produce its own sex pheromone and attract the male Solenopsis invicta.
PBAN Solenopsis invicta 3 (BBa_K1415208)
Pcons(J23101) + RBS(B0034) + PBAN(SI) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick produces Solenopsis invicta’s PBAN or not. If our biobrick works, it would be shown through the expression of the BFP gene and the emission of blue fluorescent light.
PBAN Aedes aegypti 1 (BBa_K1415009)
Peptide Sequence: DASSSNENNSRPPFAPRL
PBAN(AA)+pSB1C3 This biobrick is the PBAN of Aedes aegypti on the pSB1C3 backbone.
PBAN Aedes aegypti 2 (BBa_K1415109)
Pcons(J23101) + RBS(B0034) + PBAN(AA) This biobrick can produce Aedes aegypti’s PBAN. As Aedes aegypti’s PBAN is ingested by the female Aedes aegypti, the female Aedes aegypti will produce its own sex pheromone and attract the male Aedes aegypti.
PBAN Aedes aegypti 3 (BBa_K1415209)
Pcons(J23101) + RBS(B0034) + PBAN(AA) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick produces Aedes aegypti’s PBAN or not. If our biobrick works, it would be shown through the expression of the BFP gene and the emission of blue fluorescent light.