"
Team:NCTU Formosa/biobricks
From 2014.igem.org
(→PBAN Bombyx mori 3) |
(→PBAN-producted system) |
||
| Line 22: | Line 22: | ||
Peptide Sequence： | Peptide Sequence： | ||
LSEDMPATPADQEMYQPDPEEMESRTRYFSPRL | LSEDMPATPADQEMYQPDPEEMESRTRYFSPRL | ||
| - | <P>PBAN(BM)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.</P> | + | <P>PBAN(BM)+pSB1C3 This biobrick is the PBAN of Bombyx mori on the pSB1C3 backbone.</P> |
======PBAN Bombyx mori 2====== | ======PBAN Bombyx mori 2====== | ||
[[File:HALFBM.png|457px|link=|frameless|left]] | [[File:HALFBM.png|457px|link=|frameless|left]] | ||
<P>Pcons(J23101) + RBS(B0034) + PBAN(BM) | <P>Pcons(J23101) + RBS(B0034) + PBAN(BM) | ||
| - | This biobrick | + | This biobrick can produce Bombyx mori’s PBAN. As Bombyx mori’s PBAN is ingested by the female Bombyx mori, the female Bombyx mori will produce its own sex pheromone and attract the male Bombyx mori. </P> |
======PBAN Bombyx mori 3====== | ======PBAN Bombyx mori 3====== | ||
| - | [[File:ALLBM.png|780px|link=|frameless| | + | [[File:ALLBM.png|780px|link=|frameless|left]] |
<P>Pcons(J23101) + RBS(B0034) + PBAN(BM) + RBS(B0034) + BFP(K592100) + Ter(J61048) | <P>Pcons(J23101) + RBS(B0034) + PBAN(BM) + RBS(B0034) + BFP(K592100) + Ter(J61048) | ||
| - | This biobrick tests whether our biobrick | + | This biobrick tests whether our biobrick produces Bombyx mori’s PBAN or not. |
| - | If our biobrick works, it would be shown through the expression of the BFP gene and the emission of blue fluorescent light. | + | If our biobrick works, it would be shown through the expression of the BFP gene and the emission of blue fluorescent light. </p> |
======PBAN Mamestra brassicae 1====== | ======PBAN Mamestra brassicae 1====== | ||
| - | [[File:MB.png|276px|link=|frameless| | + | [[File:MB.png|276px|link=|frameless|left]] |
Peptide Sequence： | Peptide Sequence： | ||
LADDMPATPADQEMYRPDPEQIDSRTKYFSPRL | LADDMPATPADQEMYRPDPEQIDSRTKYFSPRL | ||
| - | <P>PBAN(MB)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.</P> | + | <P>PBAN(MB)+pSB1C3 This biobrick is the PBAN of Mamestra brassicae on the pSB1C3 backbone.</P> |
======PBAN Mamestra brassicae 2====== | ======PBAN Mamestra brassicae 2====== | ||
| - | [[File:HALFMB.png|457px|link=|frameless| | + | [[File:HALFMB.png|457px|link=|frameless|left]] |
<P>Pcons(J23101) + RBS(B0034) + PBAN(MB) | <P>Pcons(J23101) + RBS(B0034) + PBAN(MB) | ||
| - | This biobrick | + | This biobrick can produce Mamestra brassicae’s PBAN. As Mamestra brassicae’s PBAN is ingested by the female Mamestra brassicae, the female Mamestra brassicae will produce its own sex pheromone and attract the male Mamestra brassicae. </P> |
======PBAN Mamestra brassicae 3====== | ======PBAN Mamestra brassicae 3====== | ||
| - | [[File:ALLMB.png|780px|link=|frameless| | + | [[File:ALLMB.png|780px|link=|frameless|left]] |
<P>Pcons(J23101) + RBS(B0034) + PBAN(MB) + RBS(B0034) + BFP(K592100) + Ter(J61048) | <P>Pcons(J23101) + RBS(B0034) + PBAN(MB) + RBS(B0034) + BFP(K592100) + Ter(J61048) | ||
| - | This biobrick tests whether our biobrick | + | This biobrick tests whether our biobrick produces Mamestra brassicae’s PBAN or not. |
| - | If our biobrick works, it would | + | If our biobrick works, it would be shown through the expression of the BFP gene and the emission of blue fluorescent light. |
| + | </P> | ||
======PBAN Agrotis ipsilon 1====== | ======PBAN Agrotis ipsilon 1====== | ||
| - | [[File:AI.png|276px|link=|frameless| | + | [[File:AI.png|276px|link=|frameless|left]] |
Peptide Sequence： | Peptide Sequence： | ||
LADDTPATPADQEMYRPDPEQIDSRTKYFSPRL | LADDTPATPADQEMYRPDPEQIDSRTKYFSPRL | ||
| - | <P>PBAN(AI)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.</P> | + | <P>PBAN(AI)+pSB1C3 This biobrick is the PBAN of Agrotis ipsilon on the pSB1C3 backbone.</P> |
======PBAN Agrotis ipsilon 2====== | ======PBAN Agrotis ipsilon 2====== | ||
[[File:HALFAI.png|457px|link=|frameless|center]] | [[File:HALFAI.png|457px|link=|frameless|center]] | ||
<P>Pcons(J23101) + RBS(B0034) + PBAN(AI) | <P>Pcons(J23101) + RBS(B0034) + PBAN(AI) | ||
| - | This biobrick | + | This biobrick can produce Agrotis ipsilon’s PBAN. As Agrotis ipsilon’s PBAN is ingested by the female Agrotis ipsilon, the female Agrotis ipsilon will produce its own sex pheromone and attract the male Agrotis ipsilon.</P> |
======PBAN Agrotis ipsilon 3====== | ======PBAN Agrotis ipsilon 3====== | ||
Revision as of 12:32, 8 October 2014
Parts submitted to the Registry
<groupparts>iGEM014 NCTU_Formosa</groupparts>
Brief Information
Please click on the name of the parts for detailed information that is hosted in the Registry website. Team:NCTU Formosa/file/test
PBAN-producted system
PBAN Bombyx mori 1
Peptide Sequence： LSEDMPATPADQEMYQPDPEEMESRTRYFSPRL
PBAN(BM)+pSB1C3 This biobrick is the PBAN of Bombyx mori on the pSB1C3 backbone.
PBAN Bombyx mori 2
Pcons(J23101) + RBS(B0034) + PBAN(BM) This biobrick can produce Bombyx mori’s PBAN. As Bombyx mori’s PBAN is ingested by the female Bombyx mori, the female Bombyx mori will produce its own sex pheromone and attract the male Bombyx mori.
PBAN Bombyx mori 3
Pcons(J23101) + RBS(B0034) + PBAN(BM) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick produces Bombyx mori’s PBAN or not. If our biobrick works, it would be shown through the expression of the BFP gene and the emission of blue fluorescent light.
PBAN Mamestra brassicae 1
Peptide Sequence： LADDMPATPADQEMYRPDPEQIDSRTKYFSPRL
PBAN(MB)+pSB1C3 This biobrick is the PBAN of Mamestra brassicae on the pSB1C3 backbone.
PBAN Mamestra brassicae 2
Pcons(J23101) + RBS(B0034) + PBAN(MB) This biobrick can produce Mamestra brassicae’s PBAN. As Mamestra brassicae’s PBAN is ingested by the female Mamestra brassicae, the female Mamestra brassicae will produce its own sex pheromone and attract the male Mamestra brassicae.
PBAN Mamestra brassicae 3
Pcons(J23101) + RBS(B0034) + PBAN(MB) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick produces Mamestra brassicae’s PBAN or not. If our biobrick works, it would be shown through the expression of the BFP gene and the emission of blue fluorescent light.
PBAN Agrotis ipsilon 1
Peptide Sequence： LADDTPATPADQEMYRPDPEQIDSRTKYFSPRL
PBAN(AI)+pSB1C3 This biobrick is the PBAN of Agrotis ipsilon on the pSB1C3 backbone.
PBAN Agrotis ipsilon 2
Pcons(J23101) + RBS(B0034) + PBAN(AI) This biobrick can produce Agrotis ipsilon’s PBAN. As Agrotis ipsilon’s PBAN is ingested by the female Agrotis ipsilon, the female Agrotis ipsilon will produce its own sex pheromone and attract the male Agrotis ipsilon.
PBAN Agrotis ipsilon 3
Pcons(J23101) + RBS(B0034) + PBAN(AI) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.
PBAN Lymantria dispar 1
Peptide Sequence： LADDMPATMADQEVYRPEPEQIDSRNKUFSPRL
PBAN(AI)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.
PBAN Lymantria dispar 2
Pcons(J23101) + RBS(B0034) + PBAN(LD) This biobrick produces Lymantria dispar’s PBAN.
PBAN Lymantria dispar 3
Pcons(J23101) + RBS(B0034) + PBAN(LD) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.
PBAN Spodoptera litura 1
Peptide Sequence： LADDMPATPADQELYRPDPDQIDSRTKUFSPRL
PBAN(SL)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.
PBAN Spodoptera litura 2
Pcons(J23101) + RBS(B0034) + PBAN(SL) This biobrick produces Spodoptera litura’s PBAN.
PBAN Spodoptera litura 3
Pcons(J23101) + RBS(B0034) + PBAN(SL) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.
PBAN Helicoverpa armigera Hubner 1
Peptide Sequence： LSDDMPARPADQEMYRQDPEQIDSRTKYFSPRL
PBAN(HAH)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.
PBAN Helicoverpa armigera Hubner 2
Pcons(J23101) + RBS(B0034) + PBAN(HAH) This biobrick produces Helicoverpa armigera Hubner’s PBAN.
PBAN Helicoverpa armigera Hubner 3
Pcons(J23101) + RBS(B0034) + PBAN(HAH) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.
PBAN Adoxophyes sp. 1
Peptide Sequence： QSEAVTSSDEQVYRQDMSPVDGRLKYFSPRL
PBAN(AS)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.
PBAN Adoxophyes sp. 2
Pcons(J23101) + RBS(B0034) + PBAN(AS) This biobrick produces Adoxophyes sp’s PBAN.
PBAN Adoxophyes sp. 3
Pcons(J23101) + RBS(B0034) + PBAN(AS) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.
PBAN Solenopsis invicta 1
Peptide Sequence： GSGEDLSYGDAYEVDEDDHPLFVPR
PBAN(SI)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.
PBAN Solenopsis invicta 2
Pcons(J23101) + RBS(B0034) + PBAN(SI) This biobrick produces Solenopsis invicta’s PBAN.
PBAN Solenopsis invicta 3
Pcons(J23101) + RBS(B0034) + PBAN(SI) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.
PBAN Aedes aegypti 1
Peptide Sequence： DASSSNENNSRPPFAPRL
PBAN(AA)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.
PBAN Aedes aegypti 2
Pcons(J23101) + RBS(B0034) + PBAN(AA) This biobrick produces Aedes aegypti’s PBAN.
PBAN Aedes aegypti 3
Pcons(J23101) + RBS(B0034) + PBAN(AA) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.
