Team:NCTU Formosa/biobrickss

From 2014.igem.org

(Difference between revisions)
(Created page with "{{:Team:NCTU Formosa/source/head}} {{:Team:NCTU Formosa/source/header}} {{:Team:NCTU Formosa/source/cover-project}} {{:Team:NCTU Formosa/source/card}} {{:Team:NCTU Formosa/source...")
 
Line 4: Line 4:
{{:Team:NCTU Formosa/source/card}}
{{:Team:NCTU Formosa/source/card}}
{{:Team:NCTU Formosa/source/header-project}}
{{:Team:NCTU Formosa/source/header-project}}
 +
__NOTOC__
 +
<div class="li" style="clear:both"><div class="card">
 +
===Parts submitted to the Registry===
 +
 +
<groupparts>iGEM014 NCTU_Formosa</groupparts>
 +
</div>
 +
</div>
 +
<div class="li" style="clear:both"><div class="card2">
 +
 +
===Brief Information===
 +
Please click on the name of the parts for detailed information that is hosted in the Registry website.
 +
{{:Team:NCTU Formosa/file/test}}
 +
====PBAN-producted system====
 +
======PBAN Bombyx mori 1======
 +
[[File:BM.png|276px|thumb|center|alt text]]
 +
 +
Peptide Sequence：
 +
LSEDMPATPADQEMYQPDPEEMESRTRYFSPRL
 +
<P>PBAN(BM)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.</P>
 +
 +
======PBAN Bombyx mori 2======
 +
[[File:HALFBM.png|457px|thumb|center|alt text]]
 +
<P>Pcons(J23101) + RBS(B0034) + PBAN(BM)
 +
This biobrick produces Bombyx mori’s PBAN.</P>
 +
 +
======PBAN Bombyx mori 3======
 +
[[File:ALLBM.png|780px|thumb|center|alt text]]
 +
<P>Pcons(J23101) + RBS(B0034) + PBAN(BM) + RBS(B0034) + BFP(K592100) + Ter(J61048)
 +
This biobrick tests whether our biobrick work or not.
 +
If our biobrick works, it would glow blue light.</P>
 +
 +
======PBAN Mamestra brassicae 1======
 +
[[File:MB.png|200px|thumb|center|alt text]]
 +
Peptide Sequence：
 +
LADDMPATPADQEMYRPDPEQIDSRTKYFSPRL
 +
<P>PBAN(MB)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.</P>
 +
 +
======PBAN Mamestra brassicae 2======
 +
[[File:HALFMB.png|200px|thumb|center|alt text]]
 +
<P>Pcons(J23101) + RBS(B0034) + PBAN(MB)
 +
This biobrick produces Mamestra brassicae’s PBAN.</P>
 +
 +
======PBAN Mamestra brassicae 3======
 +
[[File:ALLMB.png|200px|thumb|center|alt text]]
 +
<P>Pcons(J23101) + RBS(B0034) + PBAN(MB) + RBS(B0034) + BFP(K592100) + Ter(J61048)
 +
This biobrick tests whether our biobrick work or not.
 +
If our biobrick works, it would glow blue light.</P>
 +
 +
 +
======PBAN Agrotis ipsilon 1======
 +
[[File:AI.png|200px|thumb|center|alt text]]
 +
Peptide Sequence：
 +
LADDTPATPADQEMYRPDPEQIDSRTKYFSPRL
 +
<P>PBAN(AI)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.</P>
 +
 +
======PBAN Agrotis ipsilon 2======
 +
[[File:HALFAI.png|200px|thumb|center|alt text]]
 +
<P>Pcons(J23101) + RBS(B0034) + PBAN(AI)
 +
This biobrick produces Agrotis ipsilon’s PBAN.</P>
 +
 +
======PBAN Agrotis ipsilon 3======
 +
[[File:ALLAI.png|200px|thumb|center|alt text]]
 +
<P>Pcons(J23101) + RBS(B0034) + PBAN(AI) + RBS(B0034) + BFP(K592100) + Ter(J61048)
 +
This biobrick tests whether our biobrick work or not.
 +
If our biobrick works, it would glow blue light.</P>
 +
 +
 +
======PBAN Lymantria dispar 1======
 +
[[File:LD.png|200px|thumb|center|alt text]]
 +
Peptide Sequence：
 +
LADDMPATMADQEVYRPEPEQIDSRNKUFSPRL
 +
<P>PBAN(AI)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.</P>
 +
 +
======PBAN Lymantria dispar 2======
 +
[[File:HALFLD.png|200px|thumb|center|alt text]]
 +
<P>Pcons(J23101) + RBS(B0034) + PBAN(LD)
 +
This biobrick produces Lymantria dispar’s PBAN.</P>
 +
 +
======PBAN Lymantria dispar 3======
 +
[[File:ALLLD.png|200px|thumb|center|alt text]]
 +
<P>Pcons(J23101) + RBS(B0034) + PBAN(LD) + RBS(B0034) + BFP(K592100) + Ter(J61048)
 +
This biobrick tests whether our biobrick work or not.
 +
If our biobrick works, it would glow blue light.</P>
 +
 +
======PBAN Spodoptera litura 1======
 +
[[File:SL.png|200px|thumb|center|alt text]]
 +
Peptide Sequence：
 +
LADDMPATPADQELYRPDPDQIDSRTKUFSPRL
 +
<P>PBAN(SL)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.</P>
 +
 +
======PBAN Spodoptera litura 2======
 +
[[File:HALFSL.png|200px|thumb|center|alt text]]
 +
<P>Pcons(J23101) + RBS(B0034) + PBAN(SL)
 +
This biobrick produces Spodoptera litura’s PBAN.</P>
 +
 +
======PBAN Spodoptera litura 3======
 +
[[File:ALLSL.png|200px|thumb|center|alt text]]
 +
<P>Pcons(J23101) + RBS(B0034) + PBAN(SL) + RBS(B0034) + BFP(K592100) + Ter(J61048)
 +
This biobrick tests whether our biobrick work or not.
 +
If our biobrick works, it would glow blue light.</P>
 +
 +
 +
======PBAN Helicoverpa armigera Hubner 1======
 +
[[File:HAH.png|200px|thumb|center|alt text]]
 +
Peptide Sequence：
 +
LSDDMPARPADQEMYRQDPEQIDSRTKYFSPRL
 +
<P>PBAN(HAH)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.</P>
 +
 +
======PBAN Helicoverpa armigera Hubner 2======
 +
[[File:HALFHAH.png|200px|thumb|center|alt text]]
 +
<P>Pcons(J23101) + RBS(B0034) + PBAN(HAH)
 +
This biobrick produces Helicoverpa armigera Hubner’s PBAN.</P>
 +
 +
======PBAN Helicoverpa armigera Hubner 3======
 +
[[File:ALLHAH.png|200px|thumb|center|alt text]]
 +
<P>Pcons(J23101) + RBS(B0034) + PBAN(HAH) + RBS(B0034) + BFP(K592100) + Ter(J61048)
 +
This biobrick tests whether our biobrick work or not.
 +
If our biobrick works, it would glow blue light.
 +
</P>
 +
 +
======PBAN Adoxophyes sp. 1======
 +
[[File:AS.png|200px|thumb|center|alt text]]
 +
Peptide Sequence：
 +
QSEAVTSSDEQVYRQDMSPVDGRLKYFSPRL
 +
<P>PBAN(AS)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.</P>
 +
 +
======PBAN Adoxophyes sp. 2======
 +
[[File:HALFAS.png|200px|thumb|center|alt text]]
 +
<P>Pcons(J23101) + RBS(B0034) + PBAN(AS)
 +
This biobrick produces Adoxophyes  sp’s PBAN.</P>
 +
 +
======PBAN Adoxophyes sp. 3======
 +
[[File:ALLAS.png|200px|thumb|center|alt text]]
 +
<P>Pcons(J23101) + RBS(B0034) + PBAN(AS) + RBS(B0034) + BFP(K592100) + Ter(J61048)
 +
This biobrick tests whether our biobrick work or not.
 +
If our biobrick works, it would glow blue light.</P>
 +
 +
 +
======PBAN Solenopsis invicta 1======
 +
[[File:SI.png|200px|thumb|center|alt text]]
 +
Peptide Sequence：
 +
GSGEDLSYGDAYEVDEDDHPLFVPR
 +
<P>PBAN(SI)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.</P>
 +
 +
======PBAN Solenopsis invicta 2======
 +
[[File:HALFSI.png|200px|thumb|center|alt text]]
 +
<P>Pcons(J23101) + RBS(B0034) + PBAN(SI)
 +
This biobrick produces Solenopsis invicta’s PBAN.</P>
 +
 +
======PBAN Solenopsis invicta 3======
 +
[[File:ALLSI.png|200px|thumb|center|alt text]]
 +
<P>Pcons(J23101) + RBS(B0034) + PBAN(SI) + RBS(B0034) + BFP(K592100) + Ter(J61048)
 +
This biobrick tests whether our biobrick work or not.
 +
If our biobrick works, it would glow blue light.</P>
 +
 +
 +
======PBAN Aedes aegypti 1======
 +
[[File:AA.png|200px|thumb|center|alt text]]
 +
Peptide Sequence：
 +
DASSSNENNSRPPFAPRL
 +
<P>PBAN(AA)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.</P>
 +
 +
======PBAN Aedes aegypti 2======
 +
[[File:HALFAA.png|200px|thumb|center|alt text]]
 +
<P>Pcons(J23101) + RBS(B0034) + PBAN(AA)
 +
This biobrick produces Aedes aegypti’s PBAN.</P>
 +
 +
======PBAN Aedes aegypti 3======
 +
[[File:ALLAA.png|200px|thumb|center|alt text]]
 +
<P>Pcons(J23101) + RBS(B0034) + PBAN(AA) + RBS(B0034) + BFP(K592100) + Ter(J61048)
 +
This biobrick tests whether our biobrick work or not.
 +
If our biobrick works, it would glow blue light.</P>
 +
 +
</div>
 +
</div>
 +
<html>
 +
  </div>
 +
</div>
 +
  </div>
 +
</div>
 +
<div id="footer-wrapper">
 +
  <div id="footer"> <div id="footer-text">
 +
    <p>2013 NCTU_Formosa</p>
 +
    <p class="author">Website designed by Calvin Hue.</p>
 +
    <p>Cover image credit: <a href="http://www.dvq.co.nz/" target="_blank">DVQ</a></p>
 +
    </div> </div>
 +
</div>

Latest revision as of 14:00, 5 October 2014

Project

Change the font size right here

Parts submitted to the Registry

<groupparts>iGEM014 NCTU_Formosa</groupparts>

Brief Information

Please click on the name of the parts for detailed information that is hosted in the Registry website. Team:NCTU Formosa/file/test

PBAN-producted system

PBAN Bombyx mori 1
alt text

Peptide Sequence： LSEDMPATPADQEMYQPDPEEMESRTRYFSPRL

PBAN(BM)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.

PBAN Bombyx mori 2
alt text

Pcons(J23101) + RBS(B0034) + PBAN(BM) This biobrick produces Bombyx mori’s PBAN.

PBAN Bombyx mori 3
alt text

Pcons(J23101) + RBS(B0034) + PBAN(BM) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.

PBAN Mamestra brassicae 1
alt text

Peptide Sequence： LADDMPATPADQEMYRPDPEQIDSRTKYFSPRL

PBAN(MB)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.

PBAN Mamestra brassicae 2
alt text

Pcons(J23101) + RBS(B0034) + PBAN(MB) This biobrick produces Mamestra brassicae’s PBAN.

PBAN Mamestra brassicae 3
alt text

Pcons(J23101) + RBS(B0034) + PBAN(MB) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.


PBAN Agrotis ipsilon 1
alt text

Peptide Sequence： LADDTPATPADQEMYRPDPEQIDSRTKYFSPRL

PBAN(AI)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.

PBAN Agrotis ipsilon 2
alt text

Pcons(J23101) + RBS(B0034) + PBAN(AI) This biobrick produces Agrotis ipsilon’s PBAN.

PBAN Agrotis ipsilon 3
alt text

Pcons(J23101) + RBS(B0034) + PBAN(AI) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.


PBAN Lymantria dispar 1
alt text

Peptide Sequence： LADDMPATMADQEVYRPEPEQIDSRNKUFSPRL

PBAN(AI)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.

PBAN Lymantria dispar 2
alt text

Pcons(J23101) + RBS(B0034) + PBAN(LD) This biobrick produces Lymantria dispar’s PBAN.

PBAN Lymantria dispar 3
alt text

Pcons(J23101) + RBS(B0034) + PBAN(LD) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.

PBAN Spodoptera litura 1
alt text

Peptide Sequence： LADDMPATPADQELYRPDPDQIDSRTKUFSPRL

PBAN(SL)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.

PBAN Spodoptera litura 2
alt text

Pcons(J23101) + RBS(B0034) + PBAN(SL) This biobrick produces Spodoptera litura’s PBAN.

PBAN Spodoptera litura 3
alt text

Pcons(J23101) + RBS(B0034) + PBAN(SL) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.


PBAN Helicoverpa armigera Hubner 1
alt text

Peptide Sequence： LSDDMPARPADQEMYRQDPEQIDSRTKYFSPRL

PBAN(HAH)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.

PBAN Helicoverpa armigera Hubner 2
alt text

Pcons(J23101) + RBS(B0034) + PBAN(HAH) This biobrick produces Helicoverpa armigera Hubner’s PBAN.

PBAN Helicoverpa armigera Hubner 3
alt text

Pcons(J23101) + RBS(B0034) + PBAN(HAH) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.

PBAN Adoxophyes sp. 1
alt text

Peptide Sequence： QSEAVTSSDEQVYRQDMSPVDGRLKYFSPRL

PBAN(AS)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.

PBAN Adoxophyes sp. 2
alt text

Pcons(J23101) + RBS(B0034) + PBAN(AS) This biobrick produces Adoxophyes sp’s PBAN.

PBAN Adoxophyes sp. 3
alt text

Pcons(J23101) + RBS(B0034) + PBAN(AS) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.


PBAN Solenopsis invicta 1
alt text

Peptide Sequence： GSGEDLSYGDAYEVDEDDHPLFVPR

PBAN(SI)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.

PBAN Solenopsis invicta 2
alt text

Pcons(J23101) + RBS(B0034) + PBAN(SI) This biobrick produces Solenopsis invicta’s PBAN.

PBAN Solenopsis invicta 3
alt text

Pcons(J23101) + RBS(B0034) + PBAN(SI) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.


PBAN Aedes aegypti 1
alt text

Peptide Sequence： DASSSNENNSRPPFAPRL

PBAN(AA)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.

PBAN Aedes aegypti 2
alt text

Pcons(J23101) + RBS(B0034) + PBAN(AA) This biobrick produces Aedes aegypti’s PBAN.

PBAN Aedes aegypti 3
alt text

Pcons(J23101) + RBS(B0034) + PBAN(AA) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.

Retrieved from "http://2014.igem.org/Team:NCTU_Formosa/biobrickss"