"
Team:NCTU Formosa/biobricks
From 2014.igem.org
(→PBAN3) |
(→PBAN4) |
||
| Line 33: | Line 33: | ||
<P>Introduction of Agrotis ipsilon：Agrotis ipsilon can harm hundreds of species of plants, so it is a harmful pest to agriculture. They harm larch, pine, ash, Manchurian walnut, pine, fir, mulberry, tea , Elaeagnus, fruit trees and many other seedlings.</P> | <P>Introduction of Agrotis ipsilon：Agrotis ipsilon can harm hundreds of species of plants, so it is a harmful pest to agriculture. They harm larch, pine, ash, Manchurian walnut, pine, fir, mulberry, tea , Elaeagnus, fruit trees and many other seedlings.</P> | ||
| - | ====== | + | ======PBAN Lymantria dispar====== |
| - | + | Peptide Sequence： | |
| - | < | + | LADDMPATMADQEVYRPEPEQIDSRNKUFSPRL |
| + | <P>Introduction of Lymantria dispar：Lymantria dispar is one of the most destructive pests of fruit trees throughout the Northern Hemisphere. It is also a major pest to broad leaved forest. Larvae of Lymantria dispar can cause severe leaves loss, resulting in growth retardation and even trees’ death. Moreover, its larvae and eggs can cause some allergies.</P> | ||
======PBAN5====== | ======PBAN5====== | ||
Revision as of 19:26, 18 September 2014
Parts submitted to the Registry
<groupparts>iGEM014 NCTU_Formosa</groupparts>
Brief Information
Please click on the name of the parts for detailed information that is hosted in the Registry website.
PBAN-producted system
PBAN Bombyx mori
Peptide Sequence： LSEDMPATPADQEMYQPDPEEMESRTRYFSPRL
Introduction of Bombyx mori： Silkworm is not a kind of pest. This special creature can produce raw silk, which makes them take an important position in the history of human economic life and agricultural culture. It is easy to feed and to obtain.
PBAN Mamestra brassicae
Peptide Sequence： LADDMPATPADQEMYRPDPEQIDSRTKYFSPRL
Introduction of Mamestra brassicae：Mamestra brassicae can eat up over 100 species of vegetables such as cauliflower, cabbage, radish, rape, eggplant fruit, beans, melons, potatoes and so on.
PBAN Agrotis ipsilon
Peptide Sequence： LADDTPATPADQEMYRPDPEQIDSRTKYFSPRL
Introduction of Agrotis ipsilon：Agrotis ipsilon can harm hundreds of species of plants, so it is a harmful pest to agriculture. They harm larch, pine, ash, Manchurian walnut, pine, fir, mulberry, tea , Elaeagnus, fruit trees and many other seedlings.
PBAN Lymantria dispar
Peptide Sequence： LADDMPATMADQEVYRPEPEQIDSRNKUFSPRL
Introduction of Lymantria dispar：Lymantria dispar is one of the most destructive pests of fruit trees throughout the Northern Hemisphere. It is also a major pest to broad leaved forest. Larvae of Lymantria dispar can cause severe leaves loss, resulting in growth retardation and even trees’ death. Moreover, its larvae and eggs can cause some allergies.
PBAN5
PBAN6
- By using mGFP as a reporter gene, we can test whether the 37 °C RBS works.
PBAN7
- In our circuit, this biobrick is the part of Plux's activation when the temperature reaches to 37oC.
PBAN8
- The sRNA is the complement of its rRBS. It can regulate the downstream of rRBS in RNA level by binding onto the rRBS when it is transcribed in order to interrupt ribosomes' work. In addition, adding Plux upstream makes the sequence be controlled by luxR/AHL complex.
PBAN9
- The sRNA is the complement of its rRBS. It can regulate the downstream of rRBS in RNA level by binding onto the rRBS when it is transcribed in order to interrupt ribosomes' work.
