Team:NCTU Formosa/biobricks

From 2014.igem.org

(Difference between revisions)

Latest revision as of 02:25, 18 October 2014

Project

Change the font size right here

Parts Submitted to The Registry

Please click on the name of the parts for detailed information that is hosted in the Registry website. <groupparts>iGEM014 NCTU_Formosa</groupparts>

Brief Information

PBAN Bombyx mori 1 (BBa_K1415001)

Peptide Sequence: LSEDMPATPADQEMYQPDPEEMESRTRYFSPRL

PBAN(BM)+pSB1C3 This biobrick is the PBAN of Bombyx mori on the pSB1C3 backbone.

PBAN Bombyx mori 2 (BBa_K1415101)

P_cons(BBa_J23101) + RBS(BBa_B0034) + PBAN(BM) This circuit is responsible for producing the Bombyx mori’s PBAN. As Bombyx mori PBAN is ingested by the female Bombyx mori, the female Bombyx mori will produce its own sex pheromone and attract male Bombyx moris.

PBAN Bombyx mori 3 (BBa_K1415201)

P_cons(BBa_J23101) + RBS(BBa_B0034) + PBAN(BM) + RBS(BBa_B0034) + BFP(BBa_K592100)+ Ter(BBa_J61048) The above circuit is constructed mainly to test whether it produces Bombyx mori’s PBAN. If the circuit do work, it would result in the expression of the BFP gene and emission of blue fluorescent light.

PBAN Mamestra brassicae 1 (BBa_K1415002)

Peptide Sequence: LADDMPATPADQEMYRPDPEQIDSRTKYFSPRL

PBAN(MB)+pSB1C3 This biobrick is the PBAN of Mamestra brassicae on the pSB1C3 backbone.

PBAN Mamestra brassicae 2 (BBa_K1415102)

P_cons(BBa_J23101) + RBS(BBa_B0034) + PBAN(MB) This circuit is responsible for producing the Mamestra brassicae’s PBAN. As Mamestra brassicae’s PBAN is ingested by the female Mamestra brassicae, the female Mamestra brassicae will produce its own sex pheromone and attract male Mamestra brassicaes.

PBAN Mamestra brassicae 3 (BBa_K1415202)

P_cons(BBa_J23101) + RBS(BBa_B0034) + PBAN(MB) + RBS(BBa_B0034) + BFP(BBa_K592100)+ Ter(BBa_J61048) The above circuit is constructed mainly to test whether it produces Mamestra brassicae’s PBAN. If the circuit do work, it would result in the expression of the BFP gene and emission of blue fluorescent light.

PBAN Agrotis ipsilon 1 (BBa_K1415003)

Peptide Sequence: LADDTPATPADQEMYRPDPEQIDSRTKYFSPRL

PBAN(AI)+pSB1C3 This biobrick is the PBAN of Agrotis ipsilon on the pSB1C3 backbone.

PBAN Agrotis ipsilon 2 (BBa_K1415103)

P_cons(BBa_J23101) + RBS(BBa_B0034) + PBAN(AI) This circuit is responsible for producing the Agrotis ipsilon’s PBAN. As Agrotis ipsilon’s PBAN is ingested by the female Agrotis ipsilon, the female Agrotis ipsilon will produce its own sex pheromone and attract male Agrotis ipsilons.

PBAN Agrotis ipsilon 3 (BBa_K1415203)

P_cons(BBa_J23101) + RBS(BBa_B0034) + PBAN(AI) + RBS(BBa_B0034) + BFP(BBa_K592100)+ Ter(BBa_J61048) The above circuit is constructed mainly to test whether it produces Agrotis ipsilon’s PBAN. If the circuit do work, it would result in the expression of the BFP gene and emission of blue fluorescent light.

PBAN Lymantria dispar 1 (BBa_K1415004)

Peptide Sequence: LADDMPATMADQEVYRPEPEQIDSRNKUFSPRL

PBAN(AI)+pSB1C3 This biobrick is the PBAN of Lymantria dispar on the pSB1C3 backbone.

PBAN Lymantria dispar 2 (BBa_K1415104)

P_cons(BBa_J23101) + RBS(BBa_B0034) + PBAN(LD) This circuit is responsible for producing Lymantria dispar’s PBAN. As Lymantria dispar PBAN is ingested by the female Lymantria dispar, the female Lymantria dispar will produce its own sex pheromone and attract male Lymantria dispars.

PBAN Lymantria dispar 3 (BBa_K1415204)

P_cons(BBa_J23101) + RBS(BBa_B0034) + PBAN(LD) + RBS(BBa_B0034) + BFP(BBa_K592100)+ Ter(BBa_J61048) The above circuit is constructed mainly to test whether it produces Lymantria dispar’s PBAN. If the circuit do work, it would result in the expression of the BFP gene and the emission of blue fluorescent light.

PBAN Spodoptera litura 1 (BBa_K1415005)

Peptide Sequence: LADDMPATPADQELYRPDPDQIDSRTKUFSPRL

PBAN(SL)+pSB1C3 This biobrick is the PBAN of Spodoptera litura on the pSB1C3 backbone.

PBAN Spodoptera litura 2 (BBa_K1415105)

P_cons(BBa_J23101) + RBS(BBa_B0034) + PBAN(SL) This circuit is responsible for producing the Spodoptera litura’s PBAN. As Spodoptera litura PBAN is ingested by the female Spodoptera litura, the female Spodoptera litura will produce its own sex pheromone and attract male Spodoptera lituras.

PBAN Spodoptera litura 3 (BBa_K1415205)

P_cons(BBa_J23101) + RBS(BBa_B0034) + PBAN(SL) + RBS(BBa_B0034) + BFP(BBa_K592100)+ Ter(BBa_J61048) The above circuit is constructed mainly to test whether it produces Spodoptera litura’s PBAN. If the circuit do work, it would result in the expression of the BFP gene and the emission of blue fluorescent light.

PBAN Helicoverpa armigera Hubner 1 (BBa_K1415006)

Peptide Sequence: LSDDMPARPADQEMYRQDPEQIDSRTKYFSPRL

PBAN(HAH)+pSB1C3 This biobrick is the PBAN of Helicoverpa armigera Hubner on the pSB1C3 backbone.

PBAN Helicoverpa armigera Hubner 2 (BBa_K1415106)

P_cons(BBa_J23101) + RBS(BBa_B0034) + PBAN(HAH) This circuit is responsible for producing the Helicoverpa armigera Hubner’s PBAN. As Helicoverpa armigera Hubner’s PBAN is ingested by the female Helicoverpa armigera Hubner, the female Helicoverpa armigera Hubner will produce its own sex pheromone and attract male Helicoverpa armigera Hubners.

PBAN Helicoverpa armigera Hubner 3 (BBa_K1415206)

P_cons(BBa_J23101) + RBS(BBa_B0034) + PBAN(HAH) + RBS(BBa_B0034) + BFP(BBa_K592100)+ Ter(BBa_J61048) The above circuit is constructed mainly to test whether it produces Helicoverpa armigera Hubner’s PBAN. If the circuit do work, it would result in the expression of the BFP gene and the emission of blue fluorescent light.

PBAN Adoxophyes sp. 1 (BBa_K1415007)

Peptide Sequence: QSEAVTSSDEQVYRQDMSPVDGRLKYFSPRL

PBAN(AS)+pSB1C3 This biobrick is the PBAN of Adoxophyes sp. on the pSB1C3 backbone.

PBAN Adoxophyes sp. 2 (BBa_K1415107)

P_cons(BBa_J23101) + RBS(BBa_B0034) + PBAN(AS) This circuit is responsible for producing the Adoxophyes sp.’s PBAN. As Adoxophyes sp.’s PBAN is ingested by the female Adoxophyes sp., the female Adoxophyes sp. will produce its own sex pheromone and attract male Adoxophyes sp.

PBAN Adoxophyes sp. 3 (BBa_K1415207)

P_cons(BBa_J23101) + RBS(BBa_B0034) + PBAN(AS) + RBS(BBa_B0034) + BFP(BBa_K592100)+ Ter(BBa_J61048) The above circuit is constructed mainly to test whether it produces Adoxophyes sp.’s PBAN. If the circuit do work, it would result in the expression of the BFP gene and the emission of blue fluorescent light.

PBAN Solenopsis invicta 1 (BBa_K1415008)

Peptide Sequence: GSGEDLSYGDAYEVDEDDHPLFVPR

PBAN(SI)+pSB1C3 This biobrick is the PBAN of Solenopsis invicta on the pSB1C3 backbone.

PBAN Solenopsis invicta 2 (BBa_K1415108)

P_cons(BBa_J23101) + RBS(BBa_B0034) + PBAN(SI) This circuit is responsible for producing the Solenopsis invicta’s PBAN. As Solenopsis invicta’s PBAN is ingested by the female Solenopsis invicta, the female Solenopsis invicta will produce its own sex pheromone and attract male Solenopsis invictas.

PBAN Solenopsis invicta 3 (BBa_K1415208)

P_cons(BBa_J23101) + RBS(BBa_B0034) + PBAN(SI) + RBS(BBa_B0034) + BFP(BBa_K592100)+ Ter(BBa_J61048) The above circuit is constructed mainly to test whether it produces Solenopsis invicta PBAN. If the circuit do work, it would result in the expression of the BFP gene and the emission of blue fluorescent light.

PBAN Aedes aegypti 1 (BBa_K1415009)

Peptide Sequence: DASSSNENNSRPPFAPRL

PBAN(AA)+pSB1C3 This biobrick is the PBAN of Aedes aegypti on the pSB1C3 backbone.

PBAN Aedes aegypti 2 (BBa_K1415109)

P_cons(BBa_J23101) + RBS(BBa_B0034) + PBAN(AA) This circuit is responsible for producing the Aedes aegypti’s PBAN. As Aedes aegypti’s PBAN is ingested by the female Aedes aegypti, the female Aedes aegypti will produce its own sex pheromone and attract male Aedes aegyptis.

PBAN Aedes aegypti 3 (BBa_K1415209)

P_cons(BBa_J23101) + RBS(BBa_B0034) + PBAN(AA) + RBS(BBa_B0034) + BFP(BBa_K592100)+ Ter(BBa_J61048) The above circuit is constructed mainly to test whether it produces Aedes aegypti’s PBAN. If the circuit do work, it would result in the expression of the BFP gene and the emission of blue fluorescent light.

@@ Line 1: / Line 1: @@
 {{:Team:NCTU Formosa/source/head}}
-{{:Team:NCTU Formosa/source/header}}
+{{:Team:NCTU Formosa/source/header0}}
 {{:Team:NCTU Formosa/source/cover-project}}
 {{:Team:NCTU Formosa/source/card}}
@@ Line 15: / Line 15: @@
 ===Brief Information===
-====PBAN Production====
 =====PBAN ''Bombyx mori'' 1 (BBa_K1415001)=====
 [[File:Pbanbm.png|176px|link=|frameless|left]]
-Peptide Sequence：
+Peptide Sequence:
 LSEDMPATPADQEMYQPDPEEMESRTRYFSPRL
 <P>PBAN(BM)+pSB1C3 This biobrick is the PBAN of ''Bombyx mori'' on the pSB1C3 backbone.</P>
+<h1></h1>
 =====PBAN ''Bombyx mori'' 2 (BBa_K1415101)=====
 [[File:HALFBM.png|457px|link=|frameless|left]]
-<P>Pcons(J23101) + RBS(B0034) + PBAN(BM)
+<P>P<sub>cons</sub>(BBa_J23101) + RBS(BBa_B0034) + PBAN(BM)
-This biobrick is responsible for producing the ''Bombyx mori''’s PBAN. As ''Bombyx mori'' PBAN is ingested by the female ''Bombyx mori'', the female ''Bombyx mori'' will produce its own sex pheromone and attract the male ''Bombyx mori''. </P>
+This circuit is responsible for '''producing the ''Bombyx mori''’s PBAN'''. As ''Bombyx mori'' PBAN is ingested by the female ''Bombyx mori'', the female ''Bombyx mori'' will produce its own sex pheromone and attract male ''Bombyx moris''. </P>
+<h2></h2>
 =====PBAN ''Bombyx mori'' 3 (BBa_K1415201)=====
 [[File:ALLBM.png|780px|link=|frameless|left]]
-<P>Pcons(J23101) + RBS(B0034) + PBAN(BM) + RBS(B0034) + BFP(K592100) + Ter(J61048)
+<P>P<sub>cons</sub>(BBa_J23101) + RBS(BBa_B0034) + PBAN(BM) + RBS(BBa_B0034) + BFP(BBa_K592100)+ Ter(BBa_J61048)
 The above circuit is constructed mainly to test whether it produces ''Bombyx mori''’s PBAN.
-If the biobrick do work, it would result in the expression of the BFP gene and blue fluorescent light as well. </p>
+If the circuit do work, it would result in the expression of the BFP gene and emission of blue fluorescent light. </p>
+<h1></h1>
 =====PBAN ''Mamestra brassicae'' 1 (BBa_K1415002)=====
 [[File:MB.png|276px|link=|frameless|left]]
-Peptide Sequence：
+Peptide Sequence:
 LADDMPATPADQEMYRPDPEQIDSRTKYFSPRL
 <P>PBAN(MB)+pSB1C3 This biobrick is the PBAN of ''Mamestra brassicae'' on the pSB1C3 backbone.</P>
+<h1></h1>
 =====''PBAN Mamestra brassicae'' 2 (BBa_K1415102)=====
 [[File:HALFMB.png|457px|link=|frameless|left]]
-<P>Pcons(J23101) + RBS(B0034) + PBAN(MB)
+<P>P<sub>cons</sub>(BBa_J23101) + RBS(BBa_B0034) + PBAN(MB)
-This biobrick produces the ''Mamestra brassicae'' PBAN. As ''Mamestra brassicae'' PBAN is ingested by the female ''Mamestra brassicae'', the female ''Mamestra brassicae'' will produce its own sex pheromone and attract male ''Mamestra brassicae''s. </P>
+This circuit is responsible for '''producing the ''Mamestra brassicae’s'' PBAN'''. As ''Mamestra brassicae’s'' PBAN is ingested by the female ''Mamestra brassicae'', the female ''Mamestra brassicae'' will produce its own sex pheromone and attract male ''Mamestra brassicaes''. </P>
+<h1></h1>
 =====PBAN ''Mamestra brassicae'' 3 (BBa_K1415202)=====
 [[File:ALLMB.png|780px|link=|frameless|left]]
-<P>Pcons(J23101) + RBS(B0034) + PBAN(MB) + RBS(B0034) + BFP(K592100) + Ter(J61048)
+<P>P<sub>cons</sub>(BBa_J23101) + RBS(BBa_B0034) + PBAN(MB) + RBS(BBa_B0034) + BFP(BBa_K592100)+ Ter(BBa_J61048)
 The above circuit is constructed mainly to test whether it produces ''Mamestra brassicae''’s PBAN.
-If the circuit do work, it would result in the expression of the BFP gene and blue fluorescent light as well.
+If the circuit do work, it would result in the expression of the BFP gene and emission of blue fluorescent light.
 </P>
+<h1></h1>
 =====PBAN ''Agrotis ipsilon'' 1 (BBa_K1415003)=====
 [[File:AI.png|276px|link=|frameless|left]]
-Peptide Sequence：
+Peptide Sequence:
 LADDTPATPADQEMYRPDPEQIDSRTKYFSPRL
 <P>PBAN(AI)+pSB1C3 This biobrick is the PBAN of ''Agrotis ipsilon'' on the pSB1C3 backbone.</P>
+<h1></h1>
 =====PBAN ''Agrotis ipsilon'' 2 (BBa_K1415103)=====
 [[File:HALFAI.png|457px|link=|frameless|left]]
-<P>Pcons(J23101) + RBS(B0034) + PBAN(AI)
+<P>P<sub>cons</sub>(BBa_J23101) + RBS(BBa_B0034) + PBAN(AI)
-This biobrick can produce ''Agrotis ipsilon''’s PBAN. As ''Agrotis ipsilon''’s PBAN is ingested by the female ''Agrotis ipsilon'', the female ''Agrotis ipsilon'' will produce its own sex pheromone and attract the male ''Agrotis ipsilon''.</P>
+This circuit is responsible for '''producing the ''Agrotis ipsilon''’s PBAN'''. As ''Agrotis ipsilon''’s PBAN is ingested by the female ''Agrotis ipsilon'', the female ''Agrotis ipsilon'' will produce its own sex pheromone and attract male ''Agrotis ipsilons''.</P>
+<h1></h1>
 =====PBAN ''Agrotis ipsilon'' 3 (BBa_K1415203)=====
 [[File:ALLAI.png|780px|link=|frameless|left]]
-<P>Pcons(J23101) + RBS(B0034) + PBAN(AI) + RBS(B0034) + BFP(K592100) + Ter(J61048)
+<P>P<sub>cons</sub>(BBa_J23101) + RBS(BBa_B0034) + PBAN(AI) + RBS(BBa_B0034) + BFP(BBa_K592100)+ Ter(BBa_J61048)
-This biobrick tests whether our biobrick produces ''Agrotis ipsilon''’s PBAN or not.
+The above circuit is constructed mainly to test whether it produces ''Agrotis ipsilon''’s PBAN.
-If our biobrick works, it would be shown through the expression of the BFP gene and the emission of blue fluorescent light.
+If the circuit do work, it would result in the expression of the BFP gene and emission of blue fluorescent light.
 </P>
+<h1></h1>
 =====PBAN ''Lymantria dispar'' 1 (BBa_K1415004)=====
 [[File:LD.png|276px|link=|frameless|left]]
-Peptide Sequence：
+Peptide Sequence:
 LADDMPATMADQEVYRPEPEQIDSRNKUFSPRL
 <P>PBAN(AI)+pSB1C3 This biobrick is the PBAN of ''Lymantria dispar'' on the pSB1C3 backbone.</P>
+<h1></h1>
 =====PBAN ''Lymantria dispar'' 2 (BBa_K1415104)=====
 [[File:HALFLD.png|457px|link=|frameless|left]]
-<P>Pcons(J23101) + RBS(B0034) + PBAN(LD)
+<P>P<sub>cons</sub>(BBa_J23101) + RBS(BBa_B0034) + PBAN(LD)
-This biobrick can produce ''Lymantria dispar''’s PBAN. As ''Lymantria dispar''’s PBAN is ingested by the female ''Lymantria dispar'', the female ''Lymantria dispar'' will produce its own sex pheromone and attract the male ''Lymantria dispar''.</P>
+This circuit is responsible for''' producing ''Lymantria dispar''’s PBAN'''. As ''Lymantria dispar'' PBAN is ingested by the female ''Lymantria dispar'', the female ''Lymantria dispar'' will produce its own sex pheromone and attract male ''Lymantria dispars''.</P>
+<h1></h1>
 =====PBAN ''Lymantria dispar'' 3 (BBa_K1415204)=====
 [[File:ALLLD.png|780px|link=|frameless|left]]
-<P>Pcons(J23101) + RBS(B0034) + PBAN(LD) + RBS(B0034) + BFP(K592100) + Ter(J61048)
+<P>P<sub>cons</sub>(BBa_J23101) + RBS(BBa_B0034) + PBAN(LD) + RBS(BBa_B0034) + BFP(BBa_K592100)+ Ter(BBa_J61048)
-This biobrick tests whether our biobrick produces ''Lymantria dispar''’s PBAN or not.
+The above circuit is constructed mainly to test whether it produces ''Lymantria dispar''’s PBAN.
-If our biobrick works, it would be shown through the expression of the BFP gene and the emission of blue fluorescent light.
+If the circuit do work, it would result in the expression of the BFP gene and the emission of blue fluorescent light.
 </P>
+<h1></h1>
 =====PBAN ''Spodoptera litura'' 1 (BBa_K1415005)=====
 [[File:SL.png|276px|link=|frameless|left]]
-Peptide Sequence：
+Peptide Sequence:
 LADDMPATPADQELYRPDPDQIDSRTKUFSPRL
 <P>PBAN(SL)+pSB1C3 This biobrick is the PBAN of ''Spodoptera litura'' on the pSB1C3 backbone.</P>
+<h1></h1>
 =====PBAN ''Spodoptera litura'' 2 (BBa_K1415105)=====
 [[File:HALFSL.png|457px|link=|frameless|left]]
-<P>Pcons(J23101) + RBS(B0034) + PBAN(SL)
+<P>P<sub>cons</sub>(BBa_J23101) + RBS(BBa_B0034) + PBAN(SL)
-This biobrick can produce ''Spodoptera litura''’s PBAN. As ''Spodoptera litura''’s PBAN is ingested by the female ''Spodoptera litura'', the female ''Spodoptera litura'' will produce its own sex pheromone and attract the male ''Spodoptera litura''.</P>
+This circuit is responsible for '''producing the ''Spodoptera litura''’s PBAN'''. As ''Spodoptera litura'' PBAN is ingested by the female ''Spodoptera litura'', the female ''Spodoptera litura'' will produce its own sex pheromone and attract male ''Spodoptera lituras''.</P>
+<h1></h1>
 =====PBAN ''Spodoptera litura'' 3 (BBa_K1415205)=====
 [[File:ALLSL.png|780px|link=|frameless|left]]
-<P>Pcons(J23101) + RBS(B0034) + PBAN(SL) + RBS(B0034) + BFP(K592100) + Ter(J61048)
+<P>P<sub>cons</sub>(BBa_J23101) + RBS(BBa_B0034) + PBAN(SL) + RBS(BBa_B0034) + BFP(BBa_K592100)+ Ter(BBa_J61048)
-This biobrick tests whether our biobrick produces ''Spodoptera litura''’s PBAN or not.
+The above circuit is constructed mainly to test whether it produces ''Spodoptera litura''’s PBAN.
-If our biobrick works, it would be shown through the expression of the BFP gene and the emission of blue fluorescent light.
+If the circuit do work, it would result in the expression of the BFP gene and the emission of blue fluorescent light.
 </P>
+<h1></h1>
 =====PBAN ''Helicoverpa armigera Hubner'' 1 (BBa_K1415006)=====
 [[File:HAH.png|276px|link=|frameless|left]]
-Peptide Sequence：
+Peptide Sequence:
 LSDDMPARPADQEMYRQDPEQIDSRTKYFSPRL
 <P>PBAN(HAH)+pSB1C3 This biobrick is the PBAN of ''Helicoverpa armigera Hubner'' on the pSB1C3 backbone.</P>
+<h1></h1>
 =====PBAN ''Helicoverpa armigera Hubner'' 2 (BBa_K1415106)=====
 [[File:HALFHAH.png|457px|link=|frameless|left]]
-<P>Pcons(J23101) + RBS(B0034) + PBAN(HAH)
+<P>P<sub>cons</sub>(BBa_J23101) + RBS(BBa_B0034) + PBAN(HAH)
-This biobrick can produce ''Helicoverpa armigera Hubner''’s PBAN. As ''Helicoverpa armigera Hubner''’s PBAN is ingested by the female ''Helicoverpa armigera Hubner'', the female ''Helicoverpa armigera Hubner'' will produce its own sex pheromone and attract the male ''Helicoverpa armigera Hubner''.</P>
+This circuit is responsible for''' producing the ''Helicoverpa armigera Hubner''’s PBAN'''. As ''Helicoverpa armigera Hubner''’s PBAN is ingested by the female ''Helicoverpa armigera Hubner'', the female ''Helicoverpa armigera Hubner'' will produce its own sex pheromone and attract male ''Helicoverpa armigera Hubner''s.</P>
+<h1></h1>
 =====PBAN ''Helicoverpa armigera Hubner'' 3 (BBa_K1415206)=====
 [[File:ALLHAH.png|780px|link=|frameless|left]]
-<P>Pcons(J23101) + RBS(B0034) + PBAN(HAH) + RBS(B0034) + BFP(K592100) + Ter(J61048)
+<P>P<sub>cons</sub>(BBa_J23101) + RBS(BBa_B0034) + PBAN(HAH) + RBS(BBa_B0034) + BFP(BBa_K592100)+ Ter(BBa_J61048)
-This biobrick tests whether our biobrick produces ''Helicoverpa armigera Hubner''’s PBAN or not.
+The above circuit is constructed mainly to test whether it produces ''Helicoverpa armigera Hubner''’s PBAN.
-If our biobrick works, it would be shown through the expression of the BFP gene and the emission of blue fluorescent light.
+If the circuit do work, it would result in the expression of the BFP gene and the emission of blue fluorescent light.
 </P>
+<h1></h1>
 =====PBAN ''Adoxophyes sp.'' 1 (BBa_K1415007)=====
 [[File:AS.png|276px|link=|frameless|left]]
-Peptide Sequence：
+Peptide Sequence:
 QSEAVTSSDEQVYRQDMSPVDGRLKYFSPRL
 <P>PBAN(AS)+pSB1C3 This biobrick is the PBAN of ''Adoxophyes sp.'' on the pSB1C3 backbone.</P>
+<h1></h1>
 =====PBAN ''Adoxophyes sp.'' 2 (BBa_K1415107)=====
 [[File:HALFAS.png|457px|link=|frameless|left]]
-<P>Pcons(J23101) + RBS(B0034) + PBAN(AS)
+<P>P<sub>cons</sub>(BBa_J23101) + RBS(BBa_B0034) + PBAN(AS)
-This biobrick can produce ''Adoxophyes sp.''’s PBAN. As ''Adoxophyes sp.''’s PBAN is ingested by the female ''Adoxophyes sp.'', the female ''Adoxophyes sp.'' will produce its own sex pheromone and attract the male ''Adoxophyes sp.''</P>
+This circuit is responsible for '''producing the ''Adoxophyes sp.''’s PBAN'''. As ''Adoxophyes sp.''’s PBAN is ingested by the female ''Adoxophyes sp.'', the female ''Adoxophyes sp.'' will produce its own sex pheromone and attract male ''Adoxophyes sp.''</P>
+<h1></h1>
 =====PBAN ''Adoxophyes sp.'' 3 (BBa_K1415207)=====
 [[File:ALLAS.png|780px|link=|frameless|left]]
-<P>Pcons(J23101) + RBS(B0034) + PBAN(AS) + RBS(B0034) + BFP(K592100) + Ter(J61048)
+<P>P<sub>cons</sub>(BBa_J23101) + RBS(BBa_B0034) + PBAN(AS) + RBS(BBa_B0034) + BFP(BBa_K592100)+ Ter(BBa_J61048)
-This biobrick tests whether our biobrick produces ''Adoxophyes sp.''’s PBAN or not.
+The above circuit is constructed mainly to test whether it produces ''Adoxophyes sp.''’s PBAN.
-If our biobrick works, it would be shown through the expression of the BFP gene and the emission of blue fluorescent light.
+If the circuit do work, it would result in the expression of the BFP gene and the emission of blue fluorescent light.
 </P>
+<h1></h1>
 =====PBAN ''Solenopsis invicta'' 1 (BBa_K1415008)=====
 [[File:SI.png|276px|link=|frameless|left]]
-Peptide Sequence：
+Peptide Sequence:
 GSGEDLSYGDAYEVDEDDHPLFVPR
 <P>PBAN(SI)+pSB1C3 This biobrick is the PBAN of ''Solenopsis invicta'' on the pSB1C3 backbone.</P>
+<h1></h1>
 =====PBAN ''Solenopsis invicta'' 2 (BBa_K1415108)=====
 [[File:HALFSI.png|457px|link=|frameless|left]]
-<P>Pcons(J23101) + RBS(B0034) + PBAN(SI)
+<P>P<sub>cons</sub>(BBa_J23101) + RBS(BBa_B0034) + PBAN(SI)
-This biobrick can produce ''Solenopsis invicta''’s PBAN. As ''Solenopsis invicta''’s PBAN is ingested by the female ''Solenopsis invicta'', the female ''Solenopsis invicta'' will produce its own sex pheromone and attract the male ''Solenopsis invicta''.</P>
+This circuit is responsible for '''producing the ''Solenopsis invicta''’s PBAN'''. As ''Solenopsis invicta''’s PBAN is ingested by the female ''Solenopsis invicta'', the female ''Solenopsis invicta'' will produce its own sex pheromone and attract male ''Solenopsis invicta''s.</P>
+<h1></h1>
 =====PBAN ''Solenopsis invicta'' 3 (BBa_K1415208)=====
 [[File:ALLSI.png|780px|link=|frameless|left]]
-<P>Pcons(J23101) + RBS(B0034) + PBAN(SI) + RBS(B0034) + BFP(K592100) + Ter(J61048)
+<P>P<sub>cons</sub>(BBa_J23101) + RBS(BBa_B0034) + PBAN(SI) + RBS(BBa_B0034) + BFP(BBa_K592100)+ Ter(BBa_J61048)
-This biobrick tests whether our biobrick produces ''Solenopsis invicta''’s PBAN or not.
+The above circuit is constructed mainly to test whether it produces ''Solenopsis invicta'' PBAN.
-If our biobrick works, it would be shown through the expression of the BFP gene and the emission of blue fluorescent light.
+If the circuit do work, it would result in the expression of the BFP gene and the emission of blue fluorescent light.
 </P>
+<h1></h1>
 =====PBAN ''Aedes aegypti'' 1 (BBa_K1415009)=====
 [[File:AA.png|276px|link=|frameless|left]]
-Peptide Sequence：
+Peptide Sequence:
 DASSSNENNSRPPFAPRL
 <P>PBAN(AA)+pSB1C3 This biobrick is the PBAN of ''Aedes aegypti'' on the pSB1C3 backbone.</P>
+<h1></h1>
 =====PBAN ''Aedes aegypti'' 2 (BBa_K1415109)=====
 [[File:HALFAA.png|457px|link=|frameless|left]]
-<P>Pcons(J23101) + RBS(B0034) + PBAN(AA)
+<P>P<sub>cons</sub>(BBa_J23101) + RBS(BBa_B0034) + PBAN(AA)
-This biobrick can produce ''Aedes aegypti''’s PBAN. As ''Aedes aegypti''’s PBAN is ingested by the female ''Aedes aegypti'', the female ''Aedes aegypti'' will produce its own sex pheromone and attract the male ''Aedes aegypti''.</P>
+This circuit is responsible for '''producing the ''Aedes aegypti''’s PBAN'''. As ''Aedes aegypti''’s PBAN is ingested by the female ''Aedes aegypti'', the female ''Aedes aegypti'' will produce its own sex pheromone and attract male ''Aedes aegyptis''.</P>
+<h1></h1>
 =====PBAN ''Aedes aegypti'' 3 (BBa_K1415209)=====
 [[File:ALLAA.png|780px|link=|frameless|left]]
-<P>Pcons(J23101) + RBS(B0034) + PBAN(AA) + RBS(B0034) + BFP(K592100) + Ter(J61048)
+<P>P<sub>cons</sub>(BBa_J23101) + RBS(BBa_B0034) + PBAN(AA) + RBS(BBa_B0034) + BFP(BBa_K592100)+ Ter(BBa_J61048)
-This biobrick tests whether our biobrick produces ''Aedes aegypti''’s PBAN or not.
+The above circuit is constructed mainly to test whether it produces ''Aedes aegypti''’s PBAN.
-If our biobrick works, it would be shown through the expression of the BFP gene and the emission of blue fluorescent light.
+If the circuit do work, it would result in the expression of the BFP gene and the emission of blue fluorescent light.</p>
-</P>
+<h1></h1>
   </div>
   </div>