Team:NCTU Formosa/biobricks

From 2014.igem.org

Revision as of 17:16, 4 October 2014 by Alex19950425 (Talk | contribs)

Project

Parts submitted to the Registry

<groupparts>iGEM014 NCTU_Formosa</groupparts>

Brief Information

Please click on the name of the parts for detailed information that is hosted in the Registry website. Team:NCTU Formosa/file/test

PBAN-producted system

PBAN Bombyx mori 1
alt text

Peptide Sequence: LSEDMPATPADQEMYQPDPEEMESRTRYFSPRL

PBAN(BM)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.

PBAN Bombyx mori 2
alt text

Pcons(J23101) + RBS(B0034) + PBAN(BM) This biobrick produces Bombyx mori’s PBAN.

PBAN Bombyx mori 3
alt text

Pcons(J23101) + RBS(B0034) + PBAN(BM) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.


PBAN Mamestra brassicae 1
alt text

Peptide Sequence: LADDMPATPADQEMYRPDPEQIDSRTKYFSPRL

PBAN(MB)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.

PBAN Mamestra brassicae 2
alt text

Pcons(J23101) + RBS(B0034) + PBAN(MB) This biobrick produces Mamestra brassicae’s PBAN.

PBAN Mamestra brassicae 3
alt text

Pcons(J23101) + RBS(B0034) + PBAN(MB) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.


PBAN Agrotis ipsilon 1

Peptide Sequence: LADDTPATPADQEMYRPDPEQIDSRTKYFSPRL

PBAN(AI)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.

PBAN Agrotis ipsilon 2

Pcons(J23101) + RBS(B0034) + PBAN(AI) This biobrick produces Agrotis ipsilon’s PBAN.

PBAN Agrotis ipsilon 3
alt text

Pcons(J23101) + RBS(B0034) + PBAN(AI) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.


PBAN Lymantria dispar 1
alt text

Peptide Sequence: LADDMPATMADQEVYRPEPEQIDSRNKUFSPRL

PBAN(AI)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.

PBAN Lymantria dispar 2

Pcons(J23101) + RBS(B0034) + PBAN(LD) This biobrick produces Lymantria dispar’s PBAN.

PBAN Lymantria dispar 3

Pcons(J23101) + RBS(B0034) + PBAN(LD) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.


PBAN Spodoptera litura 1
alt text

Peptide Sequence: LADDMPATPADQELYRPDPDQIDSRTKUFSPRL

PBAN(SL)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.

PBAN Spodoptera litura 2
alt text

Pcons(J23101) + RBS(B0034) + PBAN(SL) This biobrick produces Spodoptera litura’s PBAN.

PBAN Spodoptera litura 3
alt text

Pcons(J23101) + RBS(B0034) + PBAN(SL) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.


PBAN Helicoverpa armigera Hubner 1
alt text

Peptide Sequence: LSDDMPARPADQEMYRQDPEQIDSRTKYFSPRL

PBAN(HAH)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.

PBAN Helicoverpa armigera Hubner 2
alt text

Pcons(J23101) + RBS(B0034) + PBAN(HAH) This biobrick produces Helicoverpa armigera Hubner’s PBAN.

PBAN Helicoverpa armigera Hubner 3
alt text

Pcons(J23101) + RBS(B0034) + PBAN(HAH) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.

PBAN Adoxophyes sp. 1
alt text

Peptide Sequence: QSEAVTSSDEQVYRQDMSPVDGRLKYFSPRL

PBAN(AS)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.

PBAN Adoxophyes sp. 2
alt text

Pcons(J23101) + RBS(B0034) + PBAN(AS) This biobrick produces Adoxophyes sp’s PBAN.

PBAN Adoxophyes sp. 3
alt text

Pcons(J23101) + RBS(B0034) + PBAN(AS) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.


PBAN Solenopsis invicta 1
alt text

Peptide Sequence: GSGEDLSYGDAYEVDEDDHPLFVPR

PBAN(SI)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.

PBAN Solenopsis invicta 2
alt text

Pcons(J23101) + RBS(B0034) + PBAN(SI) This biobrick produces Solenopsis invicta’s PBAN.

PBAN Solenopsis invicta 3
alt text

Pcons(J23101) + RBS(B0034) + PBAN(SI) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.


PBAN Aedes aegypti 1
alt text

Peptide Sequence: DASSSNENNSRPPFAPRL

PBAN(AA)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.

PBAN Aedes aegypti 2
alt text

Pcons(J23101) + RBS(B0034) + PBAN(AA) This biobrick produces Aedes aegypti’s PBAN.

PBAN Aedes aegypti 3
alt text

Pcons(J23101) + RBS(B0034) + PBAN(AA) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.