"
Team:NCTU Formosa/biobricks
From 2014.igem.org
Alex19950425 (Talk | contribs) (→Brief Information) |
Alex19950425 (Talk | contribs) (→Brief Information) |
||
| Line 48: | Line 48: | ||
======PBAN Mamestra brassicae 3====== | ======PBAN Mamestra brassicae 3====== | ||
[[File:ALLAS.png|200px|thumb|center|alt text]] | [[File:ALLAS.png|200px|thumb|center|alt text]] | ||
| - | |||
<P>Pcons(J23101) + RBS(B0034) + PBAN(MB) + RBS(B0034) + BFP(K592100) + Ter(J61048) | <P>Pcons(J23101) + RBS(B0034) + PBAN(MB) + RBS(B0034) + BFP(K592100) + Ter(J61048) | ||
This biobrick tests whether our biobrick work or not. | This biobrick tests whether our biobrick work or not. | ||
| Line 61: | Line 60: | ||
======PBAN Agrotis ipsilon 2====== | ======PBAN Agrotis ipsilon 2====== | ||
| + | [[File:AA.png|200px|thumb|center|alt text]] | ||
<P>Pcons(J23101) + RBS(B0034) + PBAN(AI) | <P>Pcons(J23101) + RBS(B0034) + PBAN(AI) | ||
This biobrick produces Agrotis ipsilon’s PBAN.</P> | This biobrick produces Agrotis ipsilon’s PBAN.</P> | ||
======PBAN Agrotis ipsilon 3====== | ======PBAN Agrotis ipsilon 3====== | ||
| + | [[File:AA.png|200px|thumb|center|alt text]] | ||
<P>Pcons(J23101) + RBS(B0034) + PBAN(AI) + RBS(B0034) + BFP(K592100) + Ter(J61048) | <P>Pcons(J23101) + RBS(B0034) + PBAN(AI) + RBS(B0034) + BFP(K592100) + Ter(J61048) | ||
This biobrick tests whether our biobrick work or not. | This biobrick tests whether our biobrick work or not. | ||
| Line 71: | Line 72: | ||
======PBAN Lymantria dispar 1====== | ======PBAN Lymantria dispar 1====== | ||
| + | [[File:AA.png|200px|thumb|center|alt text]] | ||
Peptide Sequence： | Peptide Sequence： | ||
LADDMPATMADQEVYRPEPEQIDSRNKUFSPRL | LADDMPATMADQEVYRPEPEQIDSRNKUFSPRL | ||
| Line 76: | Line 78: | ||
======PBAN Lymantria dispar 2====== | ======PBAN Lymantria dispar 2====== | ||
| + | [[File:AA.png|200px|thumb|center|alt text]] | ||
<P>Pcons(J23101) + RBS(B0034) + PBAN(LD) | <P>Pcons(J23101) + RBS(B0034) + PBAN(LD) | ||
This biobrick produces Lymantria dispar’s PBAN.</P> | This biobrick produces Lymantria dispar’s PBAN.</P> | ||
======PBAN Lymantria dispar 3====== | ======PBAN Lymantria dispar 3====== | ||
| + | [[File:AA.png|200px|thumb|center|alt text]] | ||
<P>Pcons(J23101) + RBS(B0034) + PBAN(LD) + RBS(B0034) + BFP(K592100) + Ter(J61048) | <P>Pcons(J23101) + RBS(B0034) + PBAN(LD) + RBS(B0034) + BFP(K592100) + Ter(J61048) | ||
This biobrick tests whether our biobrick work or not. | This biobrick tests whether our biobrick work or not. | ||
| Line 86: | Line 90: | ||
======PBAN Spodoptera litura 1====== | ======PBAN Spodoptera litura 1====== | ||
| + | [[File:AA.png|200px|thumb|center|alt text]] | ||
Peptide Sequence： | Peptide Sequence： | ||
LADDMPATPADQELYRPDPDQIDSRTKUFSPRL | LADDMPATPADQELYRPDPDQIDSRTKUFSPRL | ||
| Line 91: | Line 96: | ||
======PBAN Spodoptera litura 2====== | ======PBAN Spodoptera litura 2====== | ||
| + | [[File:AA.png|200px|thumb|center|alt text]] | ||
<P>Pcons(J23101) + RBS(B0034) + PBAN(SL) | <P>Pcons(J23101) + RBS(B0034) + PBAN(SL) | ||
This biobrick produces Spodoptera litura’s PBAN.</P> | This biobrick produces Spodoptera litura’s PBAN.</P> | ||
======PBAN Spodoptera litura 3====== | ======PBAN Spodoptera litura 3====== | ||
| + | [[File:AA.png|200px|thumb|center|alt text]] | ||
<P>Pcons(J23101) + RBS(B0034) + PBAN(SL) + RBS(B0034) + BFP(K592100) + Ter(J61048) | <P>Pcons(J23101) + RBS(B0034) + PBAN(SL) + RBS(B0034) + BFP(K592100) + Ter(J61048) | ||
This biobrick tests whether our biobrick work or not. | This biobrick tests whether our biobrick work or not. | ||
| Line 101: | Line 108: | ||
======PBAN Helicoverpa armigera Hubner 1====== | ======PBAN Helicoverpa armigera Hubner 1====== | ||
| + | [[File:AA.png|200px|thumb|center|alt text]] | ||
Peptide Sequence： | Peptide Sequence： | ||
LSDDMPARPADQEMYRQDPEQIDSRTKYFSPRL | LSDDMPARPADQEMYRQDPEQIDSRTKYFSPRL | ||
| Line 106: | Line 114: | ||
======PBAN Helicoverpa armigera Hubner 2====== | ======PBAN Helicoverpa armigera Hubner 2====== | ||
| + | [[File:AA.png|200px|thumb|center|alt text]] | ||
<P>Pcons(J23101) + RBS(B0034) + PBAN(HAH) | <P>Pcons(J23101) + RBS(B0034) + PBAN(HAH) | ||
This biobrick produces Helicoverpa armigera Hubner’s PBAN.</P> | This biobrick produces Helicoverpa armigera Hubner’s PBAN.</P> | ||
======PBAN Helicoverpa armigera Hubner 3====== | ======PBAN Helicoverpa armigera Hubner 3====== | ||
| + | [[File:AA.png|200px|thumb|center|alt text]] | ||
<P>Pcons(J23101) + RBS(B0034) + PBAN(HAH) + RBS(B0034) + BFP(K592100) + Ter(J61048) | <P>Pcons(J23101) + RBS(B0034) + PBAN(HAH) + RBS(B0034) + BFP(K592100) + Ter(J61048) | ||
This biobrick tests whether our biobrick work or not. | This biobrick tests whether our biobrick work or not. | ||
| Line 116: | Line 126: | ||
======PBAN Adoxophyes sp. 1====== | ======PBAN Adoxophyes sp. 1====== | ||
| + | [[File:AA.png|200px|thumb|center|alt text]] | ||
Peptide Sequence： | Peptide Sequence： | ||
QSEAVTSSDEQVYRQDMSPVDGRLKYFSPRL | QSEAVTSSDEQVYRQDMSPVDGRLKYFSPRL | ||
| Line 121: | Line 132: | ||
======PBAN Adoxophyes sp. 2====== | ======PBAN Adoxophyes sp. 2====== | ||
| + | [[File:AA.png|200px|thumb|center|alt text]] | ||
<P>Pcons(J23101) + RBS(B0034) + PBAN(AS) | <P>Pcons(J23101) + RBS(B0034) + PBAN(AS) | ||
This biobrick produces Adoxophyes sp’s PBAN.</P> | This biobrick produces Adoxophyes sp’s PBAN.</P> | ||
======PBAN Adoxophyes sp. 3====== | ======PBAN Adoxophyes sp. 3====== | ||
| + | [[File:AA.png|200px|thumb|center|alt text]] | ||
<P>Pcons(J23101) + RBS(B0034) + PBAN(AS) + RBS(B0034) + BFP(K592100) + Ter(J61048) | <P>Pcons(J23101) + RBS(B0034) + PBAN(AS) + RBS(B0034) + BFP(K592100) + Ter(J61048) | ||
This biobrick tests whether our biobrick work or not. | This biobrick tests whether our biobrick work or not. | ||
| Line 131: | Line 144: | ||
======PBAN Solenopsis invicta 1====== | ======PBAN Solenopsis invicta 1====== | ||
| + | [[File:AA.png|200px|thumb|center|alt text]] | ||
Peptide Sequence： | Peptide Sequence： | ||
GSGEDLSYGDAYEVDEDDHPLFVPR | GSGEDLSYGDAYEVDEDDHPLFVPR | ||
| Line 136: | Line 150: | ||
======PBAN Solenopsis invicta 2====== | ======PBAN Solenopsis invicta 2====== | ||
| + | [[File:AA.png|200px|thumb|center|alt text]] | ||
<P>Pcons(J23101) + RBS(B0034) + PBAN(SI) | <P>Pcons(J23101) + RBS(B0034) + PBAN(SI) | ||
This biobrick produces Solenopsis invicta’s PBAN.</P> | This biobrick produces Solenopsis invicta’s PBAN.</P> | ||
======PBAN Solenopsis invicta 3====== | ======PBAN Solenopsis invicta 3====== | ||
| + | [[File:AA.png|200px|thumb|center|alt text]] | ||
<P>Pcons(J23101) + RBS(B0034) + PBAN(SI) + RBS(B0034) + BFP(K592100) + Ter(J61048) | <P>Pcons(J23101) + RBS(B0034) + PBAN(SI) + RBS(B0034) + BFP(K592100) + Ter(J61048) | ||
This biobrick tests whether our biobrick work or not. | This biobrick tests whether our biobrick work or not. | ||
| Line 146: | Line 162: | ||
======PBAN Aedes aegypti 1====== | ======PBAN Aedes aegypti 1====== | ||
| + | [[File:AA.png|200px|thumb|center|alt text]] | ||
Peptide Sequence： | Peptide Sequence： | ||
DASSSNENNSRPPFAPRL | DASSSNENNSRPPFAPRL | ||
| Line 151: | Line 168: | ||
======PBAN Aedes aegypti 2====== | ======PBAN Aedes aegypti 2====== | ||
| + | [[File:AA.png|200px|thumb|center|alt text]] | ||
<P>Pcons(J23101) + RBS(B0034) + PBAN(AA) | <P>Pcons(J23101) + RBS(B0034) + PBAN(AA) | ||
This biobrick produces Aedes aegypti’s PBAN.</P> | This biobrick produces Aedes aegypti’s PBAN.</P> | ||
======PBAN Aedes aegypti 3====== | ======PBAN Aedes aegypti 3====== | ||
| + | [[File:AA.png|200px|thumb|center|alt text]] | ||
<P>Pcons(J23101) + RBS(B0034) + PBAN(AA) + RBS(B0034) + BFP(K592100) + Ter(J61048) | <P>Pcons(J23101) + RBS(B0034) + PBAN(AA) + RBS(B0034) + BFP(K592100) + Ter(J61048) | ||
This biobrick tests whether our biobrick work or not. | This biobrick tests whether our biobrick work or not. | ||
Revision as of 17:04, 4 October 2014
Parts submitted to the Registry
<groupparts>iGEM014 NCTU_Formosa</groupparts>
Brief Information
Please click on the name of the parts for detailed information that is hosted in the Registry website. Team:NCTU Formosa/file/test
PBAN-producted system
PBAN Bombyx mori 1
Peptide Sequence： LSEDMPATPADQEMYQPDPEEMESRTRYFSPRL
PBAN(BM)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.
PBAN Bombyx mori 2
Pcons(J23101) + RBS(B0034) + PBAN(BM) This biobrick produces Bombyx mori’s PBAN.
PBAN Bombyx mori 3
Pcons(J23101) + RBS(B0034) + PBAN(BM) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.
PBAN Mamestra brassicae 1
Peptide Sequence： LADDMPATPADQEMYRPDPEQIDSRTKYFSPRL
PBAN(MB)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.
PBAN Mamestra brassicae 2
Pcons(J23101) + RBS(B0034) + PBAN(MB) This biobrick produces Mamestra brassicae’s PBAN.
PBAN Mamestra brassicae 3
Pcons(J23101) + RBS(B0034) + PBAN(MB) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.
PBAN Agrotis ipsilon 1
Peptide Sequence： LADDTPATPADQEMYRPDPEQIDSRTKYFSPRL
PBAN(AI)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.
PBAN Agrotis ipsilon 2
Pcons(J23101) + RBS(B0034) + PBAN(AI) This biobrick produces Agrotis ipsilon’s PBAN.
PBAN Agrotis ipsilon 3
Pcons(J23101) + RBS(B0034) + PBAN(AI) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.
PBAN Lymantria dispar 1
Peptide Sequence： LADDMPATMADQEVYRPEPEQIDSRNKUFSPRL
PBAN(AI)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.
PBAN Lymantria dispar 2
Pcons(J23101) + RBS(B0034) + PBAN(LD) This biobrick produces Lymantria dispar’s PBAN.
PBAN Lymantria dispar 3
Pcons(J23101) + RBS(B0034) + PBAN(LD) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.
PBAN Spodoptera litura 1
Peptide Sequence： LADDMPATPADQELYRPDPDQIDSRTKUFSPRL
PBAN(SL)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.
PBAN Spodoptera litura 2
Pcons(J23101) + RBS(B0034) + PBAN(SL) This biobrick produces Spodoptera litura’s PBAN.
PBAN Spodoptera litura 3
Pcons(J23101) + RBS(B0034) + PBAN(SL) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.
PBAN Helicoverpa armigera Hubner 1
Peptide Sequence： LSDDMPARPADQEMYRQDPEQIDSRTKYFSPRL
PBAN(HAH)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.
PBAN Helicoverpa armigera Hubner 2
Pcons(J23101) + RBS(B0034) + PBAN(HAH) This biobrick produces Helicoverpa armigera Hubner’s PBAN.
PBAN Helicoverpa armigera Hubner 3
Pcons(J23101) + RBS(B0034) + PBAN(HAH) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.
PBAN Adoxophyes sp. 1
Peptide Sequence： QSEAVTSSDEQVYRQDMSPVDGRLKYFSPRL
PBAN(AS)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.
PBAN Adoxophyes sp. 2
Pcons(J23101) + RBS(B0034) + PBAN(AS) This biobrick produces Adoxophyes sp’s PBAN.
PBAN Adoxophyes sp. 3
Pcons(J23101) + RBS(B0034) + PBAN(AS) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.
PBAN Solenopsis invicta 1
Peptide Sequence： GSGEDLSYGDAYEVDEDDHPLFVPR
PBAN(SI)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.
PBAN Solenopsis invicta 2
Pcons(J23101) + RBS(B0034) + PBAN(SI) This biobrick produces Solenopsis invicta’s PBAN.
PBAN Solenopsis invicta 3
Pcons(J23101) + RBS(B0034) + PBAN(SI) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.
PBAN Aedes aegypti 1
Peptide Sequence： DASSSNENNSRPPFAPRL
PBAN(AA)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.
PBAN Aedes aegypti 2
Pcons(J23101) + RBS(B0034) + PBAN(AA) This biobrick produces Aedes aegypti’s PBAN.
PBAN Aedes aegypti 3
Pcons(J23101) + RBS(B0034) + PBAN(AA) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.
