Team:NCTU Formosa/biobricks

From 2014.igem.org

(Difference between revisions)

Revision as of 17:02, 4 October 2014

Top

Project

Parts submitted to the Registry

<groupparts>iGEM014 NCTU_Formosa</groupparts>

Brief Information

Please click on the name of the parts for detailed information that is hosted in the Registry website. Team:NCTU Formosa/file/test

PBAN-producted system

PBAN Bombyx mori 1

alt text

Peptide Sequence： LSEDMPATPADQEMYQPDPEEMESRTRYFSPRL

PBAN(BM)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.

PBAN Bombyx mori 2

alt text

Pcons(J23101) + RBS(B0034) + PBAN(BM) This biobrick produces Bombyx mori’s PBAN.

PBAN Bombyx mori 3

alt text

Pcons(J23101) + RBS(B0034) + PBAN(BM) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.

PBAN Mamestra brassicae 1

alt text

Peptide Sequence： LADDMPATPADQEMYRPDPEQIDSRTKYFSPRL

PBAN(MB)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.

PBAN Mamestra brassicae 2

alt text

Pcons(J23101) + RBS(B0034) + PBAN(MB) This biobrick produces Mamestra brassicae’s PBAN.

PBAN Mamestra brassicae 3

alt text

Pcons(J23101) + RBS(B0034) + PBAN(MB) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.

PBAN Agrotis ipsilon 1

alt text

Peptide Sequence： LADDTPATPADQEMYRPDPEQIDSRTKYFSPRL

PBAN(AI)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.

PBAN Agrotis ipsilon 2

Pcons(J23101) + RBS(B0034) + PBAN(AI) This biobrick produces Agrotis ipsilon’s PBAN.

PBAN Agrotis ipsilon 3

Pcons(J23101) + RBS(B0034) + PBAN(AI) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.

PBAN Lymantria dispar 1

Peptide Sequence： LADDMPATMADQEVYRPEPEQIDSRNKUFSPRL

PBAN(AI)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.

PBAN Lymantria dispar 2

Pcons(J23101) + RBS(B0034) + PBAN(LD) This biobrick produces Lymantria dispar’s PBAN.

PBAN Lymantria dispar 3

Pcons(J23101) + RBS(B0034) + PBAN(LD) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.

PBAN Spodoptera litura 1

Peptide Sequence： LADDMPATPADQELYRPDPDQIDSRTKUFSPRL

PBAN(SL)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.

PBAN Spodoptera litura 2

Pcons(J23101) + RBS(B0034) + PBAN(SL) This biobrick produces Spodoptera litura’s PBAN.

PBAN Spodoptera litura 3

Pcons(J23101) + RBS(B0034) + PBAN(SL) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.

PBAN Helicoverpa armigera Hubner 1

Peptide Sequence： LSDDMPARPADQEMYRQDPEQIDSRTKYFSPRL

PBAN(HAH)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.

PBAN Helicoverpa armigera Hubner 2

Pcons(J23101) + RBS(B0034) + PBAN(HAH) This biobrick produces Helicoverpa armigera Hubner’s PBAN.

PBAN Helicoverpa armigera Hubner 3

Pcons(J23101) + RBS(B0034) + PBAN(HAH) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.

PBAN Adoxophyes sp. 1

Peptide Sequence： QSEAVTSSDEQVYRQDMSPVDGRLKYFSPRL

PBAN(AS)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.

PBAN Adoxophyes sp. 2

Pcons(J23101) + RBS(B0034) + PBAN(AS) This biobrick produces Adoxophyes sp’s PBAN.

PBAN Adoxophyes sp. 3

Pcons(J23101) + RBS(B0034) + PBAN(AS) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.

PBAN Solenopsis invicta 1

Peptide Sequence： GSGEDLSYGDAYEVDEDDHPLFVPR

PBAN(SI)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.

PBAN Solenopsis invicta 2

Pcons(J23101) + RBS(B0034) + PBAN(SI) This biobrick produces Solenopsis invicta’s PBAN.

PBAN Solenopsis invicta 3

Pcons(J23101) + RBS(B0034) + PBAN(SI) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.

PBAN Aedes aegypti 1

Peptide Sequence： DASSSNENNSRPPFAPRL

PBAN(AA)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.

PBAN Aedes aegypti 2

Pcons(J23101) + RBS(B0034) + PBAN(AA) This biobrick produces Aedes aegypti’s PBAN.

PBAN Aedes aegypti 3

Pcons(J23101) + RBS(B0034) + PBAN(AA) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.

@@ Line 24: / Line 24: @@
 ======PBAN Bombyx mori 2======
-[[File:AI.png|200px|thumb|center|alt text]]
+[[File:AA.png|200px|thumb|center|alt text]]
 <P>Pcons(J23101) + RBS(B0034) + PBAN(BM)
 This biobrick produces Bombyx mori’s PBAN.</P>
 ======PBAN Bombyx mori 3======
+[[File:AI.png|200px|thumb|center|alt text]]
 <P>Pcons(J23101) + RBS(B0034) + PBAN(BM) + RBS(B0034) + BFP(K592100) + Ter(J61048)
 This biobrick tests whether our biobrick work or not.
@@ Line 35: / Line 36: @@
 ======PBAN Mamestra brassicae 1======
+[[File:ALLAA.png|200px|thumb|center|alt text]]
 Peptide Sequence：
 LADDMPATPADQEMYRPDPEQIDSRTKYFSPRL
@@ Line 40: / Line 42: @@
 ======PBAN Mamestra brassicae 2======
+[[File:ALLAI.png|200px|thumb|center|alt text]]
 <P>Pcons(J23101) + RBS(B0034) + PBAN(MB)
 This biobrick produces Mamestra brassicae’s PBAN.</P>
 ======PBAN Mamestra brassicae 3======
+[[File:ALLAS.png|200px|thumb|center|alt text]]
 <P>Pcons(J23101) + RBS(B0034) + PBAN(MB) + RBS(B0034) + BFP(K592100) + Ter(J61048)
 This biobrick tests whether our biobrick work or not.
@@ Line 50: / Line 55: @@
 ======PBAN Agrotis ipsilon 1======
+[[File:AA.png|200px|thumb|center|alt text]]
 Peptide Sequence：
 LADDTPATPADQEMYRPDPEQIDSRTKYFSPRL