"
Team:NCTU Formosa/biobricks
From 2014.igem.org
| Line 29: | Line 29: | ||
| - | ======PBAN Mamestra brassicae====== | + | ======PBAN Mamestra brassicae 1====== |
Peptide Sequence： | Peptide Sequence： | ||
LADDMPATPADQEMYRPDPEQIDSRTKYFSPRL | LADDMPATPADQEMYRPDPEQIDSRTKYFSPRL | ||
| + | <P>PBAN(MB)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.</P> | ||
| + | ======PBAN Mamestra brassicae 2====== | ||
<P>Pcons(J23101) + RBS(B0034) + PBAN(MB) | <P>Pcons(J23101) + RBS(B0034) + PBAN(MB) | ||
This biobrick produces Mamestra brassicae’s PBAN.</P> | This biobrick produces Mamestra brassicae’s PBAN.</P> | ||
| - | <P>RBS(B0034) + BFP(K592100) + Ter(J61048) | + | ======PBAN Mamestra brassicae 3====== |
| + | <P>Pcons(J23101) + RBS(B0034) + PBAN(MB) + RBS(B0034) + BFP(K592100) + Ter(J61048) | ||
This biobrick tests whether our biobrick work or not. | This biobrick tests whether our biobrick work or not. | ||
| - | If our biobrick works , it would glow blue light.</P> | + | If our biobrick works, it would glow blue light.</P> |
| - | ======PBAN Agrotis ipsilon====== | + | ======PBAN Agrotis ipsilon 1====== |
Peptide Sequence： | Peptide Sequence： | ||
LADDTPATPADQEMYRPDPEQIDSRTKYFSPRL | LADDTPATPADQEMYRPDPEQIDSRTKYFSPRL | ||
| + | <P>PBAN(AI)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.</P> | ||
| + | ======PBAN Agrotis ipsilon 2====== | ||
<P>Pcons(J23101) + RBS(B0034) + PBAN(AI) | <P>Pcons(J23101) + RBS(B0034) + PBAN(AI) | ||
This biobrick produces Agrotis ipsilon’s PBAN.</P> | This biobrick produces Agrotis ipsilon’s PBAN.</P> | ||
| - | <P>RBS(B0034) + BFP(K592100) + Ter(J61048) | + | ======PBAN Agrotis ipsilon 3====== |
| + | <P>Pcons(J23101) + RBS(B0034) + PBAN(AI) + RBS(B0034) + BFP(K592100) + Ter(J61048) | ||
This biobrick tests whether our biobrick work or not. | This biobrick tests whether our biobrick work or not. | ||
| - | If our biobrick works , it would glow blue light.</P> | + | If our biobrick works, it would glow blue light.</P> |
| - | ======PBAN Lymantria dispar====== | + | ======PBAN Lymantria dispar 1====== |
Peptide Sequence： | Peptide Sequence： | ||
LADDMPATMADQEVYRPEPEQIDSRNKUFSPRL | LADDMPATMADQEVYRPEPEQIDSRNKUFSPRL | ||
| + | <P>PBAN(AI)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.</P> | ||
| + | |||
| + | ======PBAN Lymantria dispar 2====== | ||
<P>Pcons(J23101) + RBS(B0034) + PBAN(LD) | <P>Pcons(J23101) + RBS(B0034) + PBAN(LD) | ||
This biobrick produces Lymantria dispar’s PBAN.</P> | This biobrick produces Lymantria dispar’s PBAN.</P> | ||
| - | <P>RBS(B0034) + BFP(K592100) + Ter(J61048) | + | ======PBAN Lymantria dispar 3====== |
| + | <P>Pcons(J23101) + RBS(B0034) + PBAN(LD) + RBS(B0034) + BFP(K592100) + Ter(J61048) | ||
This biobrick tests whether our biobrick work or not. | This biobrick tests whether our biobrick work or not. | ||
| - | If our biobrick works , it would glow blue light.</P> | + | If our biobrick works, it would glow blue light.</P> |
| - | ======PBAN Spodoptera litura====== | + | ======PBAN Spodoptera litura 1====== |
Peptide Sequence： | Peptide Sequence： | ||
LADDMPATPADQELYRPDPDQIDSRTKUFSPRL | LADDMPATPADQELYRPDPDQIDSRTKUFSPRL | ||
| + | <P>PBAN(SL)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.</P> | ||
| + | |||
| + | ======PBAN Spodoptera litura 2====== | ||
<P>Pcons(J23101) + RBS(B0034) + PBAN(SL) | <P>Pcons(J23101) + RBS(B0034) + PBAN(SL) | ||
This biobrick produces Spodoptera litura’s PBAN.</P> | This biobrick produces Spodoptera litura’s PBAN.</P> | ||
| - | <P>RBS(B0034) + BFP(K592100) + Ter(J61048) | + | ======PBAN Spodoptera litura 3====== |
| + | <P>Pcons(J23101) + RBS(B0034) + PBAN(SL) + RBS(B0034) + BFP(K592100) + Ter(J61048) | ||
This biobrick tests whether our biobrick work or not. | This biobrick tests whether our biobrick work or not. | ||
If our biobrick works , it would glow blue light.</P> | If our biobrick works , it would glow blue light.</P> | ||
| - | ======PBAN Helicoverpa armigera Hubner====== | + | ======PBAN Helicoverpa armigera Hubner 1====== |
Peptide Sequence： | Peptide Sequence： | ||
LSDDMPARPADQEMYRQDPEQIDSRTKYFSPRL | LSDDMPARPADQEMYRQDPEQIDSRTKYFSPRL | ||
| + | <P>PBAN(HAH)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.</P> | ||
| + | |||
| + | ======PBAN Helicoverpa armigera Hubner 2====== | ||
<P>Pcons(J23101) + RBS(B0034) + PBAN(HAH) | <P>Pcons(J23101) + RBS(B0034) + PBAN(HAH) | ||
This biobrick produces Helicoverpa armigera Hubner’s PBAN.</P> | This biobrick produces Helicoverpa armigera Hubner’s PBAN.</P> | ||
| - | <P>RBS(B0034) + BFP(K592100) + Ter(J61048) | + | ======PBAN Helicoverpa armigera Hubner 3====== |
| + | <P>Pcons(J23101) + RBS(B0034) + PBAN(HAH) + RBS(B0034) + BFP(K592100) + Ter(J61048) | ||
This biobrick tests whether our biobrick work or not. | This biobrick tests whether our biobrick work or not. | ||
| - | If our biobrick works , it would glow blue light. | + | If our biobrick works, it would glow blue light. |
</P> | </P> | ||
| - | ======PBAN Adoxophyes sp.====== | + | ======PBAN Adoxophyes sp. 1====== |
Peptide Sequence： | Peptide Sequence： | ||
QSEAVTSSDEQVYRQDMSPVDGRLKYFSPRL | QSEAVTSSDEQVYRQDMSPVDGRLKYFSPRL | ||
| + | <P>PBAN(AS)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.</P> | ||
| + | |||
| + | ======PBAN Adoxophyes sp. 2====== | ||
<P>Pcons(J23101) + RBS(B0034) + PBAN(AS) | <P>Pcons(J23101) + RBS(B0034) + PBAN(AS) | ||
This biobrick produces Adoxophyes sp’s PBAN.</P> | This biobrick produces Adoxophyes sp’s PBAN.</P> | ||
| - | <P>RBS(B0034) + BFP(K592100) + Ter(J61048) | + | ======PBAN Adoxophyes sp. 3====== |
| + | <P>Pcons(J23101) + RBS(B0034) + PBAN(AS) + RBS(B0034) + BFP(K592100) + Ter(J61048) | ||
This biobrick tests whether our biobrick work or not. | This biobrick tests whether our biobrick work or not. | ||
If our biobrick works , it would glow blue light.</P> | If our biobrick works , it would glow blue light.</P> | ||
| - | ======PBAN Solenopsis invicta====== | + | ======PBAN Solenopsis invicta 1====== |
Peptide Sequence： | Peptide Sequence： | ||
GSGEDLSYGDAYEVDEDDHPLFVPR | GSGEDLSYGDAYEVDEDDHPLFVPR | ||
| + | <P>PBAN(SI)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.</P> | ||
| + | |||
| + | ======PBAN Solenopsis invicta 2====== | ||
<P>Pcons(J23101) + RBS(B0034) + PBAN(SI) | <P>Pcons(J23101) + RBS(B0034) + PBAN(SI) | ||
This biobrick produces Solenopsis invicta’s PBAN.</P> | This biobrick produces Solenopsis invicta’s PBAN.</P> | ||
| - | <P>RBS(B0034) + BFP(K592100) + Ter(J61048) | + | ======PBAN Solenopsis invicta 3====== |
| + | <P>Pcons(J23101) + RBS(B0034) + PBAN(SI) + RBS(B0034) + BFP(K592100) + Ter(J61048) | ||
This biobrick tests whether our biobrick work or not. | This biobrick tests whether our biobrick work or not. | ||
If our biobrick works , it would glow blue light.</P> | If our biobrick works , it would glow blue light.</P> | ||
| - | ======PBAN Aedes aegypti====== | + | ======PBAN Aedes aegypti 1====== |
Peptide Sequence： | Peptide Sequence： | ||
DASSSNENNSRPPFAPRL | DASSSNENNSRPPFAPRL | ||
| + | <P>PBAN(AA)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.</P> | ||
| + | |||
| + | ======PBAN Aedes aegypti 2====== | ||
<P>Pcons(J23101) + RBS(B0034) + PBAN(AA) | <P>Pcons(J23101) + RBS(B0034) + PBAN(AA) | ||
This biobrick produces Aedes aegypti’s PBAN.</P> | This biobrick produces Aedes aegypti’s PBAN.</P> | ||
| - | <P>RBS(B0034) + BFP(K592100) + Ter(J61048) | + | ======PBAN Aedes aegypti 3====== |
| + | <P>Pcons(J23101) + RBS(B0034) + PBAN(AA) + RBS(B0034) + BFP(K592100) + Ter(J61048) | ||
This biobrick tests whether our biobrick work or not. | This biobrick tests whether our biobrick work or not. | ||
| - | If our biobrick works , it would glow blue light.</P> | + | If our biobrick works, it would glow blue light.</P> |
</div> | </div> | ||
Revision as of 15:59, 24 September 2014
Parts submitted to the Registry
<groupparts>iGEM014 NCTU_Formosa</groupparts>
Brief Information
Please click on the name of the parts for detailed information that is hosted in the Registry website.
PBAN-producted system
PBAN Bombyx mori 1
Peptide Sequence： LSEDMPATPADQEMYQPDPEEMESRTRYFSPRL
PBAN(BM)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.
PBAN Bombyx mori 2
Pcons(J23101) + RBS(B0034) + PBAN(BM) This biobrick produces Bombyx mori’s PBAN.
PBAN Bombyx mori 3
Pcons(J23101) + RBS(B0034) + PBAN(BM) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.
PBAN Mamestra brassicae 1
Peptide Sequence： LADDMPATPADQEMYRPDPEQIDSRTKYFSPRL
PBAN(MB)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.
PBAN Mamestra brassicae 2
Pcons(J23101) + RBS(B0034) + PBAN(MB) This biobrick produces Mamestra brassicae’s PBAN.
PBAN Mamestra brassicae 3
Pcons(J23101) + RBS(B0034) + PBAN(MB) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.
PBAN Agrotis ipsilon 1
Peptide Sequence： LADDTPATPADQEMYRPDPEQIDSRTKYFSPRL
PBAN(AI)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.
PBAN Agrotis ipsilon 2
Pcons(J23101) + RBS(B0034) + PBAN(AI) This biobrick produces Agrotis ipsilon’s PBAN.
PBAN Agrotis ipsilon 3
Pcons(J23101) + RBS(B0034) + PBAN(AI) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.
PBAN Lymantria dispar 1
Peptide Sequence： LADDMPATMADQEVYRPEPEQIDSRNKUFSPRL
PBAN(AI)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.
PBAN Lymantria dispar 2
Pcons(J23101) + RBS(B0034) + PBAN(LD) This biobrick produces Lymantria dispar’s PBAN.
PBAN Lymantria dispar 3
Pcons(J23101) + RBS(B0034) + PBAN(LD) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.
PBAN Spodoptera litura 1
Peptide Sequence： LADDMPATPADQELYRPDPDQIDSRTKUFSPRL
PBAN(SL)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.
PBAN Spodoptera litura 2
Pcons(J23101) + RBS(B0034) + PBAN(SL) This biobrick produces Spodoptera litura’s PBAN.
PBAN Spodoptera litura 3
Pcons(J23101) + RBS(B0034) + PBAN(SL) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works , it would glow blue light.
PBAN Helicoverpa armigera Hubner 1
Peptide Sequence： LSDDMPARPADQEMYRQDPEQIDSRTKYFSPRL
PBAN(HAH)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.
PBAN Helicoverpa armigera Hubner 2
Pcons(J23101) + RBS(B0034) + PBAN(HAH) This biobrick produces Helicoverpa armigera Hubner’s PBAN.
PBAN Helicoverpa armigera Hubner 3
Pcons(J23101) + RBS(B0034) + PBAN(HAH) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.
PBAN Adoxophyes sp. 1
Peptide Sequence： QSEAVTSSDEQVYRQDMSPVDGRLKYFSPRL
PBAN(AS)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.
PBAN Adoxophyes sp. 2
Pcons(J23101) + RBS(B0034) + PBAN(AS) This biobrick produces Adoxophyes sp’s PBAN.
PBAN Adoxophyes sp. 3
Pcons(J23101) + RBS(B0034) + PBAN(AS) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works , it would glow blue light.
PBAN Solenopsis invicta 1
Peptide Sequence： GSGEDLSYGDAYEVDEDDHPLFVPR
PBAN(SI)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.
PBAN Solenopsis invicta 2
Pcons(J23101) + RBS(B0034) + PBAN(SI) This biobrick produces Solenopsis invicta’s PBAN.
PBAN Solenopsis invicta 3
Pcons(J23101) + RBS(B0034) + PBAN(SI) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works , it would glow blue light.
PBAN Aedes aegypti 1
Peptide Sequence： DASSSNENNSRPPFAPRL
PBAN(AA)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.
PBAN Aedes aegypti 2
Pcons(J23101) + RBS(B0034) + PBAN(AA) This biobrick produces Aedes aegypti’s PBAN.
PBAN Aedes aegypti 3
Pcons(J23101) + RBS(B0034) + PBAN(AA) + RBS(B0034) + BFP(K592100) + Ter(J61048) This biobrick tests whether our biobrick work or not. If our biobrick works, it would glow blue light.
