Team:NCTU Formosa/biobricks

From 2014.igem.org

(Difference between revisions)
(→PBAN Agrotis ipsilon 1)
(→PBAN Spodoptera litura 2 (BBa_K1415105))
 
(178 intermediate revisions not shown)
Line 1: Line 1:
{{:Team:NCTU Formosa/source/head}}
{{:Team:NCTU Formosa/source/head}}
-
{{:Team:NCTU Formosa/source/header-biobricks}}
+
{{:Team:NCTU Formosa/source/header0}}
-
{{:Team:NCTU Formosa/source/header}}
+
{{:Team:NCTU Formosa/source/cover-project}}
-
{{:Team:NCTU Formosa/source/cover-biobricks}}
+
{{:Team:NCTU Formosa/source/card}}
{{:Team:NCTU Formosa/source/card}}
 +
{{:Team:NCTU Formosa/source/header-biobricks}}
__NOTOC__
__NOTOC__
-
<div class="li" style="clear:both"><div class="card">
+
<div class="li" style="clear:both"><div class="card2">
-
===Parts submitted to the Registry===
+
===Parts Submitted to The Registry===
-
 
+
Please click on the name of the parts for detailed information that is hosted in the Registry website.
<groupparts>iGEM014 NCTU_Formosa</groupparts>
<groupparts>iGEM014 NCTU_Formosa</groupparts>
</div>
</div>
</div>
</div>
-
<div class="li" style="clear:both"><div class="card">
+
<div class="li" style="clear:both"><div class="card2">
===Brief Information===
===Brief Information===
-
Please click on the name of the parts for detailed information that is hosted in the Registry website.
 
-
{{:Team:NCTU Formosa/file/test}}
 
-
====PBAN-producted system====
 
-
======PBAN Bombyx mori 1======
 
-
[[File:BM.png|200px|thumb|center|alt text]]
 
-
Peptide Sequence：
 
-
LSEDMPATPADQEMYQPDPEEMESRTRYFSPRL
 
-
<P>PBAN(BM)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.</P>
 
-
======PBAN Bombyx mori 2======
 
-
[[File:AA.png|200px|thumb|center|alt text]]
 
-
<P>Pcons(J23101) + RBS(B0034) + PBAN(BM)
 
-
This biobrick produces Bombyx mori’s PBAN.</P>
 
-
======PBAN Bombyx mori 3======
+
=====PBAN ''Bombyx mori'' 1 (BBa_K1415001)=====
-
[[File:AI.png|200px|thumb|center|alt text]]
+
[[File:Pbanbm.png|176px|link=|frameless|left]]
-
<P>Pcons(J23101) + RBS(B0034) + PBAN(BM) + RBS(B0034) + BFP(K592100) + Ter(J61048)  
+
Peptide Sequence:
-
This biobrick tests whether our biobrick work or not.
+
LSEDMPATPADQEMYQPDPEEMESRTRYFSPRL
-
If our biobrick works, it would glow blue light.</P>
+
<P>PBAN(BM)+pSB1C3 This biobrick is the PBAN of ''Bombyx mori'' on the pSB1C3 backbone.</P>
 +
<h1></h1>
 +
=====PBAN ''Bombyx mori'' 2 (BBa_K1415101)=====
 +
[[File:HALFBM.png|457px|link=|frameless|left]]
 +
<P>P<sub>cons</sub>(BBa_J23101) + RBS(BBa_B0034) + PBAN(BM)  
 +
This circuit is responsible for '''producing the ''Bombyx mori''’s PBAN'''. As ''Bombyx mori'' PBAN is ingested by the female ''Bombyx mori'', the female ''Bombyx mori'' will produce its own sex pheromone and attract male ''Bombyx moris''. </P>
 +
<h2></h2>
-
 
+
=====PBAN ''Bombyx mori'' 3 (BBa_K1415201)=====
-
======PBAN Mamestra brassicae 1======
+
[[File:ALLBM.png|780px|link=|frameless|left]]
-
[[File:ALLAA.png|200px|thumb|center|alt text]]
+
<P>P<sub>cons</sub>(BBa_J23101) + RBS(BBa_B0034) + PBAN(BM) + RBS(BBa_B0034) + BFP(BBa_K592100)+ Ter(BBa_J61048)
-
Peptide Sequence：
+
The above circuit is constructed mainly to test whether it produces ''Bombyx mori''’s PBAN.
 +
If the circuit do work, it would result in the expression of the BFP gene and emission of blue fluorescent light. </p>
 +
<h1></h1>
 +
=====PBAN ''Mamestra brassicae'' 1 (BBa_K1415002)=====
 +
[[File:MB.png|276px|link=|frameless|left]]
 +
Peptide Sequence:
LADDMPATPADQEMYRPDPEQIDSRTKYFSPRL
LADDMPATPADQEMYRPDPEQIDSRTKYFSPRL
-
<P>PBAN(MB)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.</P>
+
<P>PBAN(MB)+pSB1C3 This biobrick is the PBAN of ''Mamestra brassicae'' on the pSB1C3 backbone.</P>
-
 
+
<h1></h1>
-
======PBAN Mamestra brassicae 2======
+
=====''PBAN Mamestra brassicae'' 2 (BBa_K1415102)=====
-
[[File:ALLAI.png|200px|thumb|center|alt text]]
+
[[File:HALFMB.png|457px|link=|frameless|left]]
-
<P>Pcons(J23101) + RBS(B0034) + PBAN(MB)  
+
<P>P<sub>cons</sub>(BBa_J23101) + RBS(BBa_B0034) + PBAN(MB)  
-
This biobrick produces Mamestra brassicae’s PBAN.</P>
+
This circuit is responsible for '''producing the ''Mamestra brassicae’s'' PBAN'''. As ''Mamestra brassicae’s'' PBAN is ingested by the female ''Mamestra brassicae'', the female ''Mamestra brassicae'' will produce its own sex pheromone and attract male ''Mamestra brassicaes''. </P>
-
 
+
<h1></h1>
-
======PBAN Mamestra brassicae 3======
+
=====PBAN ''Mamestra brassicae'' 3 (BBa_K1415202)=====
-
[[File:ALLAS.png|200px|thumb|center|alt text]]
+
[[File:ALLMB.png|780px|link=|frameless|left]]
-
<P>Pcons(J23101) + RBS(B0034) + PBAN(MB) + RBS(B0034) + BFP(K592100) + Ter(J61048)  
+
<P>P<sub>cons</sub>(BBa_J23101) + RBS(BBa_B0034) + PBAN(MB) + RBS(BBa_B0034) + BFP(BBa_K592100)+ Ter(BBa_J61048)
-
This biobrick tests whether our biobrick work or not.
+
The above circuit is constructed mainly to test whether it produces ''Mamestra brassicae''’s PBAN.
-
If our biobrick works, it would glow blue light.</P>
+
If the circuit do work, it would result in the expression of the BFP gene and emission of blue fluorescent light.
-
 
+
</P>
-
 
+
<h1></h1>
-
======PBAN Agrotis ipsilon 1======
+
=====PBAN ''Agrotis ipsilon'' 1 (BBa_K1415003)=====
-
[[File:AALMB.png|200px|thumb|center|alt text]]
+
[[File:AI.png|276px|link=|frameless|left]]
-
Peptide Sequence：
+
Peptide Sequence:
LADDTPATPADQEMYRPDPEQIDSRTKYFSPRL
LADDTPATPADQEMYRPDPEQIDSRTKYFSPRL
-
<P>PBAN(AI)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.</P>
+
<P>PBAN(AI)+pSB1C3 This biobrick is the PBAN of ''Agrotis ipsilon'' on the pSB1C3 backbone.</P>
-
 
+
<h1></h1>
-
======PBAN Agrotis ipsilon 2======
+
=====PBAN ''Agrotis ipsilon'' 2 (BBa_K1415103)=====
-
[[File:AALHAH.png|200px|thumb|center|alt text]]
+
[[File:HALFAI.png|457px|link=|frameless|left]]
-
<P>Pcons(J23101) + RBS(B0034) + PBAN(AI)  
+
<P>P<sub>cons</sub>(BBa_J23101) + RBS(BBa_B0034) + PBAN(AI)  
-
This biobrick produces Agrotis ipsilon’s PBAN.</P>
+
This circuit is responsible for '''producing the ''Agrotis ipsilon''’s PBAN'''. As ''Agrotis ipsilon''’s PBAN is ingested by the female ''Agrotis ipsilon'', the female ''Agrotis ipsilon'' will produce its own sex pheromone and attract male ''Agrotis ipsilons''.</P>
-
 
+
<h1></h1>
-
======PBAN Agrotis ipsilon 3======
+
=====PBAN ''Agrotis ipsilon'' 3 (BBa_K1415203)=====
-
[[File:ALLLD.png|200px|thumb|center|alt text]]
+
[[File:ALLAI.png|780px|link=|frameless|left]]
-
<P>Pcons(J23101) + RBS(B0034) + PBAN(AI) + RBS(B0034) + BFP(K592100) + Ter(J61048)  
+
<P>P<sub>cons</sub>(BBa_J23101) + RBS(BBa_B0034) + PBAN(AI) + RBS(BBa_B0034) + BFP(BBa_K592100)+ Ter(BBa_J61048)
-
This biobrick tests whether our biobrick work or not.
+
The above circuit is constructed mainly to test whether it produces ''Agrotis ipsilon''’s PBAN.
-
If our biobrick works, it would glow blue light.</P>
+
If the circuit do work, it would result in the expression of the BFP gene and emission of blue fluorescent light.
-
 
+
</P>
-
 
+
<h1></h1>
-
======PBAN Lymantria dispar 1======
+
=====PBAN ''Lymantria dispar'' 1 (BBa_K1415004)=====
-
[[File:ALLMB.png|200px|thumb|center|alt text]]
+
[[File:LD.png|276px|link=|frameless|left]]
-
Peptide Sequence：
+
Peptide Sequence:
LADDMPATMADQEVYRPEPEQIDSRNKUFSPRL
LADDMPATMADQEVYRPEPEQIDSRNKUFSPRL
-
<P>PBAN(AI)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.</P>
+
<P>PBAN(AI)+pSB1C3 This biobrick is the PBAN of ''Lymantria dispar'' on the pSB1C3 backbone.</P>
 +
<h1></h1>
 +
=====PBAN ''Lymantria dispar'' 2 (BBa_K1415104)=====
 +
[[File:HALFLD.png|457px|link=|frameless|left]]
 +
<P>P<sub>cons</sub>(BBa_J23101) + RBS(BBa_B0034) + PBAN(LD)
 +
This circuit is responsible for''' producing ''Lymantria dispar''’s PBAN'''. As ''Lymantria dispar'' PBAN is ingested by the female ''Lymantria dispar'', the female ''Lymantria dispar'' will produce its own sex pheromone and attract male ''Lymantria dispars''.</P>
 +
<h1></h1>
 +
=====PBAN ''Lymantria dispar'' 3 (BBa_K1415204)=====
 +
[[File:ALLLD.png|780px|link=|frameless|left]]
 +
<P>P<sub>cons</sub>(BBa_J23101) + RBS(BBa_B0034) + PBAN(LD) + RBS(BBa_B0034) + BFP(BBa_K592100)+ Ter(BBa_J61048)
 +
The above circuit is constructed mainly to test whether it produces ''Lymantria dispar''’s PBAN.
 +
If the circuit do work, it would result in the expression of the BFP gene and the emission of blue fluorescent light.
-
======PBAN Lymantria dispar 2======
+
</P>
-
[[File:AALSI.png|200px|thumb|center|alt text]]
+
<h1></h1>
-
<P>Pcons(J23101) + RBS(B0034) + PBAN(LD)
+
=====PBAN ''Spodoptera litura'' 1 (BBa_K1415005)=====
-
This biobrick produces Lymantria dispar’s PBAN.</P>
+
[[File:SL.png|276px|link=|frameless|left]]
-
 
+
Peptide Sequence:
-
======PBAN Lymantria dispar 3======
+
-
[[File:AALSL.png|200px|thumb|center|alt text]]
+
-
<P>Pcons(J23101) + RBS(B0034) + PBAN(LD) + RBS(B0034) + BFP(K592100) + Ter(J61048)
+
-
This biobrick tests whether our biobrick work or not.
+
-
If our biobrick works, it would glow blue light.</P>
+
-
 
+
-
 
+
-
======PBAN Spodoptera litura 1======
+
-
[[File:AA.png|200px|thumb|center|alt text]]
+
-
Peptide Sequence：
+
LADDMPATPADQELYRPDPDQIDSRTKUFSPRL
LADDMPATPADQELYRPDPDQIDSRTKUFSPRL
-
<P>PBAN(SL)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.</P>
+
<P>PBAN(SL)+pSB1C3 This biobrick is the PBAN of ''Spodoptera litura'' on the pSB1C3 backbone.</P>
 +
<h1></h1>
 +
=====PBAN ''Spodoptera litura'' 2 (BBa_K1415105)=====
 +
[[File:HALFSL.png|457px|link=|frameless|left]]
 +
<P>P<sub>cons</sub>(BBa_J23101) + RBS(BBa_B0034) + PBAN(SL)
 +
This circuit is responsible for '''producing the ''Spodoptera litura''’s PBAN'''. As ''Spodoptera litura'' PBAN is ingested by the female ''Spodoptera litura'', the female ''Spodoptera litura'' will produce its own sex pheromone and attract male ''Spodoptera lituras''.</P>
 +
<h1></h1>
-
======PBAN Spodoptera litura 2======
+
=====PBAN ''Spodoptera litura'' 3 (BBa_K1415205)=====
-
[[File:AA.png|200px|thumb|center|alt text]]
+
[[File:ALLSL.png|780px|link=|frameless|left]]
-
<P>Pcons(J23101) + RBS(B0034) + PBAN(SL)
+
<P>P<sub>cons</sub>(BBa_J23101) + RBS(BBa_B0034) + PBAN(SL) + RBS(BBa_B0034) + BFP(BBa_K592100)+ Ter(BBa_J61048)
-
This biobrick produces Spodoptera litura’s PBAN.</P>
+
The above circuit is constructed mainly to test whether it produces ''Spodoptera litura''’s PBAN.
-
 
+
If the circuit do work, it would result in the expression of the BFP gene and the emission of blue fluorescent light.
-
======PBAN Spodoptera litura 3======
+
</P>
-
[[File:AA.png|200px|thumb|center|alt text]]
+
<h1></h1>
-
<P>Pcons(J23101) + RBS(B0034) + PBAN(SL) + RBS(B0034) + BFP(K592100) + Ter(J61048)  
+
=====PBAN ''Helicoverpa armigera Hubner'' 1 (BBa_K1415006)=====
-
This biobrick tests whether our biobrick work or not.
+
[[File:HAH.png|276px|link=|frameless|left]]
-
If our biobrick works, it would glow blue light.</P>
+
Peptide Sequence:
-
 
+
-
 
+
-
======PBAN Helicoverpa armigera Hubner 1======
+
-
[[File:AA.png|200px|thumb|center|alt text]]
+
-
Peptide Sequence：
+
LSDDMPARPADQEMYRQDPEQIDSRTKYFSPRL
LSDDMPARPADQEMYRQDPEQIDSRTKYFSPRL
-
<P>PBAN(HAH)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.</P>
+
<P>PBAN(HAH)+pSB1C3 This biobrick is the PBAN of ''Helicoverpa armigera Hubner'' on the pSB1C3 backbone.</P>
-
 
+
<h1></h1>
-
======PBAN Helicoverpa armigera Hubner 2======
+
=====PBAN ''Helicoverpa armigera Hubner'' 2 (BBa_K1415106)=====
-
[[File:AA.png|200px|thumb|center|alt text]]
+
[[File:HALFHAH.png|457px|link=|frameless|left]]
-
<P>Pcons(J23101) + RBS(B0034) + PBAN(HAH)  
+
<P>P<sub>cons</sub>(BBa_J23101) + RBS(BBa_B0034) + PBAN(HAH)  
-
This biobrick produces Helicoverpa armigera Hubner’s PBAN.</P>
+
This circuit is responsible for''' producing the ''Helicoverpa armigera Hubner''’s PBAN'''. As ''Helicoverpa armigera Hubner''’s PBAN is ingested by the female ''Helicoverpa armigera Hubner'', the female ''Helicoverpa armigera Hubner'' will produce its own sex pheromone and attract male ''Helicoverpa armigera Hubner''s.</P>
-
 
+
<h1></h1>
-
======PBAN Helicoverpa armigera Hubner 3======
+
=====PBAN ''Helicoverpa armigera Hubner'' 3 (BBa_K1415206)=====
-
[[File:AA.png|200px|thumb|center|alt text]]
+
[[File:ALLHAH.png|780px|link=|frameless|left]]
-
<P>Pcons(J23101) + RBS(B0034) + PBAN(HAH) + RBS(B0034) + BFP(K592100) + Ter(J61048)  
+
<P>P<sub>cons</sub>(BBa_J23101) + RBS(BBa_B0034) + PBAN(HAH) + RBS(BBa_B0034) + BFP(BBa_K592100)+ Ter(BBa_J61048)
-
This biobrick tests whether our biobrick work or not.
+
The above circuit is constructed mainly to test whether it produces ''Helicoverpa armigera Hubner''’s PBAN.
-
If our biobrick works, it would glow blue light.
+
If the circuit do work, it would result in the expression of the BFP gene and the emission of blue fluorescent light.
</P>
</P>
-
 
+
<h1></h1>
-
======PBAN Adoxophyes sp. 1======
+
=====PBAN ''Adoxophyes sp.'' 1 (BBa_K1415007)=====
-
[[File:AA.png|200px|thumb|center|alt text]]
+
[[File:AS.png|276px|link=|frameless|left]]
-
Peptide Sequence：
+
Peptide Sequence:
QSEAVTSSDEQVYRQDMSPVDGRLKYFSPRL
QSEAVTSSDEQVYRQDMSPVDGRLKYFSPRL
-
<P>PBAN(AS)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.</P>
+
<P>PBAN(AS)+pSB1C3 This biobrick is the PBAN of ''Adoxophyes sp.'' on the pSB1C3 backbone.</P>
-
 
+
<h1></h1>
-
======PBAN Adoxophyes sp. 2======
+
=====PBAN ''Adoxophyes sp.'' 2 (BBa_K1415107)=====
-
[[File:AA.png|200px|thumb|center|alt text]]
+
[[File:HALFAS.png|457px|link=|frameless|left]]
-
<P>Pcons(J23101) + RBS(B0034) + PBAN(AS)  
+
<P>P<sub>cons</sub>(BBa_J23101) + RBS(BBa_B0034) + PBAN(AS)  
-
This biobrick produces Adoxophyes sp’s PBAN.</P>
+
This circuit is responsible for '''producing the ''Adoxophyes sp.''’s PBAN'''. As ''Adoxophyes sp.''’s PBAN is ingested by the female ''Adoxophyes sp.'', the female ''Adoxophyes sp.'' will produce its own sex pheromone and attract male ''Adoxophyes sp.''</P>
-
 
+
<h1></h1>
-
======PBAN Adoxophyes sp. 3======
+
=====PBAN ''Adoxophyes sp.'' 3 (BBa_K1415207)=====
-
[[File:AA.png|200px|thumb|center|alt text]]
+
[[File:ALLAS.png|780px|link=|frameless|left]]
-
<P>Pcons(J23101) + RBS(B0034) + PBAN(AS) + RBS(B0034) + BFP(K592100) + Ter(J61048)  
+
<P>P<sub>cons</sub>(BBa_J23101) + RBS(BBa_B0034) + PBAN(AS) + RBS(BBa_B0034) + BFP(BBa_K592100)+ Ter(BBa_J61048)
-
This biobrick tests whether our biobrick work or not.
+
The above circuit is constructed mainly to test whether it produces ''Adoxophyes sp.''’s PBAN.
-
If our biobrick works, it would glow blue light.</P>
+
If the circuit do work, it would result in the expression of the BFP gene and the emission of blue fluorescent light.
-
 
+
</P>
-
 
+
<h1></h1>
-
======PBAN Solenopsis invicta 1======
+
=====PBAN ''Solenopsis invicta'' 1 (BBa_K1415008)=====
-
[[File:AA.png|200px|thumb|center|alt text]]
+
[[File:SI.png|276px|link=|frameless|left]]
-
Peptide Sequence：
+
Peptide Sequence:
GSGEDLSYGDAYEVDEDDHPLFVPR
GSGEDLSYGDAYEVDEDDHPLFVPR
-
<P>PBAN(SI)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.</P>
+
<P>PBAN(SI)+pSB1C3 This biobrick is the PBAN of ''Solenopsis invicta'' on the pSB1C3 backbone.</P>
-
 
+
<h1></h1>
-
======PBAN Solenopsis invicta 2======
+
=====PBAN ''Solenopsis invicta'' 2 (BBa_K1415108)=====
-
[[File:AA.png|200px|thumb|center|alt text]]
+
[[File:HALFSI.png|457px|link=|frameless|left]]
-
<P>Pcons(J23101) + RBS(B0034) + PBAN(SI)  
+
<P>P<sub>cons</sub>(BBa_J23101) + RBS(BBa_B0034) + PBAN(SI)  
-
This biobrick produces Solenopsis invicta’s PBAN.</P>
+
This circuit is responsible for '''producing the ''Solenopsis invicta''’s PBAN'''. As ''Solenopsis invicta''’s PBAN is ingested by the female ''Solenopsis invicta'', the female ''Solenopsis invicta'' will produce its own sex pheromone and attract male ''Solenopsis invicta''s.</P>
-
 
+
<h1></h1>
-
======PBAN Solenopsis invicta 3======
+
=====PBAN ''Solenopsis invicta'' 3 (BBa_K1415208)=====
-
[[File:AA.png|200px|thumb|center|alt text]]
+
[[File:ALLSI.png|780px|link=|frameless|left]]
-
<P>Pcons(J23101) + RBS(B0034) + PBAN(SI) + RBS(B0034) + BFP(K592100) + Ter(J61048)  
+
<P>P<sub>cons</sub>(BBa_J23101) + RBS(BBa_B0034) + PBAN(SI) + RBS(BBa_B0034) + BFP(BBa_K592100)+ Ter(BBa_J61048)
-
This biobrick tests whether our biobrick work or not.
+
The above circuit is constructed mainly to test whether it produces ''Solenopsis invicta'' PBAN.
-
If our biobrick works, it would glow blue light.</P>
+
If the circuit do work, it would result in the expression of the BFP gene and the emission of blue fluorescent light.
-
 
+
</P>
-
 
+
<h1></h1>
-
======PBAN Aedes aegypti 1======
+
=====PBAN ''Aedes aegypti'' 1 (BBa_K1415009)=====
-
[[File:AA.png|200px|thumb|center|alt text]]
+
[[File:AA.png|276px|link=|frameless|left]]
-
Peptide Sequence：
+
Peptide Sequence:
DASSSNENNSRPPFAPRL
DASSSNENNSRPPFAPRL
-
<P>PBAN(AA)+pSB1C3 This biobrick is the PBAN on the pSB1C3 backbone.</P>
+
<P>PBAN(AA)+pSB1C3 This biobrick is the PBAN of ''Aedes aegypti'' on the pSB1C3 backbone.</P>
-
 
+
<h1></h1>
-
======PBAN Aedes aegypti 2======
+
=====PBAN ''Aedes aegypti'' 2 (BBa_K1415109)=====
-
[[File:AA.png|200px|thumb|center|alt text]]
+
[[File:HALFAA.png|457px|link=|frameless|left]]
-
<P>Pcons(J23101) + RBS(B0034) + PBAN(AA)  
+
<P>P<sub>cons</sub>(BBa_J23101) + RBS(BBa_B0034) + PBAN(AA)  
-
This biobrick produces Aedes aegypti’s PBAN.</P>
+
This circuit is responsible for '''producing the ''Aedes aegypti''’s PBAN'''. As ''Aedes aegypti''’s PBAN is ingested by the female ''Aedes aegypti'', the female ''Aedes aegypti'' will produce its own sex pheromone and attract male ''Aedes aegyptis''.</P>
-
 
+
<h1></h1>
-
======PBAN Aedes aegypti 3======
+
=====PBAN ''Aedes aegypti'' 3 (BBa_K1415209)=====
-
[[File:AA.png|200px|thumb|center|alt text]]
+
[[File:ALLAA.png|780px|link=|frameless|left]]
-
<P>Pcons(J23101) + RBS(B0034) + PBAN(AA) + RBS(B0034) + BFP(K592100) + Ter(J61048)  
+
<P>P<sub>cons</sub>(BBa_J23101) + RBS(BBa_B0034) + PBAN(AA) + RBS(BBa_B0034) + BFP(BBa_K592100)+ Ter(BBa_J61048)
-
This biobrick tests whether our biobrick work or not.
+
The above circuit is constructed mainly to test whether it produces ''Aedes aegypti''’s PBAN.
-
If our biobrick works, it would glow blue light.</P>
+
If the circuit do work, it would result in the expression of the BFP gene and the emission of blue fluorescent light.</p>
-
 
+
<h1></h1>
  </div>
  </div>
  </div>
  </div>
-
<html>
 
-
  </div>
 
-
</div>
 
-
  </div>
 
-
</div>
 
-
<div id="footer-wrapper">
 
-
  <div id="footer"> <div id="footer-text">
 
-
    <p>2013 NCTU_Formosa</p>
 
-
    <p class="author">Website designed by Calvin Hue.</p>
 
-
    <p>Cover image credit: <a href="http://www.dvq.co.nz/" target="_blank">DVQ</a></p>
 
-
    </div> </div>
 
-
</div>
 

Latest revision as of 02:25, 18 October 2014

Project

Change the font size right here

Parts Submitted to The Registry

Please click on the name of the parts for detailed information that is hosted in the Registry website. <groupparts>iGEM014 NCTU_Formosa</groupparts>

Brief Information

PBAN Bombyx mori 1 (BBa_K1415001)
Pbanbm.png

Peptide Sequence: LSEDMPATPADQEMYQPDPEEMESRTRYFSPRL

PBAN(BM)+pSB1C3 This biobrick is the PBAN of Bombyx mori on the pSB1C3 backbone.

PBAN Bombyx mori 2 (BBa_K1415101)
HALFBM.png

Pcons(BBa_J23101) + RBS(BBa_B0034) + PBAN(BM) This circuit is responsible for producing the Bombyx mori’s PBAN. As Bombyx mori PBAN is ingested by the female Bombyx mori, the female Bombyx mori will produce its own sex pheromone and attract male Bombyx moris.

PBAN Bombyx mori 3 (BBa_K1415201)
ALLBM.png

Pcons(BBa_J23101) + RBS(BBa_B0034) + PBAN(BM) + RBS(BBa_B0034) + BFP(BBa_K592100)+ Ter(BBa_J61048) The above circuit is constructed mainly to test whether it produces Bombyx mori’s PBAN. If the circuit do work, it would result in the expression of the BFP gene and emission of blue fluorescent light.

PBAN Mamestra brassicae 1 (BBa_K1415002)
MB.png

Peptide Sequence: LADDMPATPADQEMYRPDPEQIDSRTKYFSPRL

PBAN(MB)+pSB1C3 This biobrick is the PBAN of Mamestra brassicae on the pSB1C3 backbone.

PBAN Mamestra brassicae 2 (BBa_K1415102)
HALFMB.png

Pcons(BBa_J23101) + RBS(BBa_B0034) + PBAN(MB) This circuit is responsible for producing the Mamestra brassicae’s PBAN. As Mamestra brassicae’s PBAN is ingested by the female Mamestra brassicae, the female Mamestra brassicae will produce its own sex pheromone and attract male Mamestra brassicaes.

PBAN Mamestra brassicae 3 (BBa_K1415202)
ALLMB.png

Pcons(BBa_J23101) + RBS(BBa_B0034) + PBAN(MB) + RBS(BBa_B0034) + BFP(BBa_K592100)+ Ter(BBa_J61048) The above circuit is constructed mainly to test whether it produces Mamestra brassicae’s PBAN. If the circuit do work, it would result in the expression of the BFP gene and emission of blue fluorescent light.

PBAN Agrotis ipsilon 1 (BBa_K1415003)
AI.png

Peptide Sequence: LADDTPATPADQEMYRPDPEQIDSRTKYFSPRL

PBAN(AI)+pSB1C3 This biobrick is the PBAN of Agrotis ipsilon on the pSB1C3 backbone.

PBAN Agrotis ipsilon 2 (BBa_K1415103)
HALFAI.png

Pcons(BBa_J23101) + RBS(BBa_B0034) + PBAN(AI) This circuit is responsible for producing the Agrotis ipsilon’s PBAN. As Agrotis ipsilon’s PBAN is ingested by the female Agrotis ipsilon, the female Agrotis ipsilon will produce its own sex pheromone and attract male Agrotis ipsilons.

PBAN Agrotis ipsilon 3 (BBa_K1415203)
ALLAI.png

Pcons(BBa_J23101) + RBS(BBa_B0034) + PBAN(AI) + RBS(BBa_B0034) + BFP(BBa_K592100)+ Ter(BBa_J61048) The above circuit is constructed mainly to test whether it produces Agrotis ipsilon’s PBAN. If the circuit do work, it would result in the expression of the BFP gene and emission of blue fluorescent light.

PBAN Lymantria dispar 1 (BBa_K1415004)
LD.png

Peptide Sequence: LADDMPATMADQEVYRPEPEQIDSRNKUFSPRL

PBAN(AI)+pSB1C3 This biobrick is the PBAN of Lymantria dispar on the pSB1C3 backbone.

PBAN Lymantria dispar 2 (BBa_K1415104)
HALFLD.png

Pcons(BBa_J23101) + RBS(BBa_B0034) + PBAN(LD) This circuit is responsible for producing Lymantria dispar’s PBAN. As Lymantria dispar PBAN is ingested by the female Lymantria dispar, the female Lymantria dispar will produce its own sex pheromone and attract male Lymantria dispars.

PBAN Lymantria dispar 3 (BBa_K1415204)
ALLLD.png

Pcons(BBa_J23101) + RBS(BBa_B0034) + PBAN(LD) + RBS(BBa_B0034) + BFP(BBa_K592100)+ Ter(BBa_J61048) The above circuit is constructed mainly to test whether it produces Lymantria dispar’s PBAN. If the circuit do work, it would result in the expression of the BFP gene and the emission of blue fluorescent light.

PBAN Spodoptera litura 1 (BBa_K1415005)
SL.png

Peptide Sequence: LADDMPATPADQELYRPDPDQIDSRTKUFSPRL

PBAN(SL)+pSB1C3 This biobrick is the PBAN of Spodoptera litura on the pSB1C3 backbone.

PBAN Spodoptera litura 2 (BBa_K1415105)
HALFSL.png

Pcons(BBa_J23101) + RBS(BBa_B0034) + PBAN(SL) This circuit is responsible for producing the Spodoptera litura’s PBAN. As Spodoptera litura PBAN is ingested by the female Spodoptera litura, the female Spodoptera litura will produce its own sex pheromone and attract male Spodoptera lituras.

PBAN Spodoptera litura 3 (BBa_K1415205)
ALLSL.png

Pcons(BBa_J23101) + RBS(BBa_B0034) + PBAN(SL) + RBS(BBa_B0034) + BFP(BBa_K592100)+ Ter(BBa_J61048) The above circuit is constructed mainly to test whether it produces Spodoptera litura’s PBAN. If the circuit do work, it would result in the expression of the BFP gene and the emission of blue fluorescent light.

PBAN Helicoverpa armigera Hubner 1 (BBa_K1415006)
HAH.png

Peptide Sequence: LSDDMPARPADQEMYRQDPEQIDSRTKYFSPRL

PBAN(HAH)+pSB1C3 This biobrick is the PBAN of Helicoverpa armigera Hubner on the pSB1C3 backbone.

PBAN Helicoverpa armigera Hubner 2 (BBa_K1415106)
HALFHAH.png

Pcons(BBa_J23101) + RBS(BBa_B0034) + PBAN(HAH) This circuit is responsible for producing the Helicoverpa armigera Hubner’s PBAN. As Helicoverpa armigera Hubner’s PBAN is ingested by the female Helicoverpa armigera Hubner, the female Helicoverpa armigera Hubner will produce its own sex pheromone and attract male Helicoverpa armigera Hubners.

PBAN Helicoverpa armigera Hubner 3 (BBa_K1415206)
ALLHAH.png

Pcons(BBa_J23101) + RBS(BBa_B0034) + PBAN(HAH) + RBS(BBa_B0034) + BFP(BBa_K592100)+ Ter(BBa_J61048) The above circuit is constructed mainly to test whether it produces Helicoverpa armigera Hubner’s PBAN. If the circuit do work, it would result in the expression of the BFP gene and the emission of blue fluorescent light.

PBAN Adoxophyes sp. 1 (BBa_K1415007)
AS.png

Peptide Sequence: QSEAVTSSDEQVYRQDMSPVDGRLKYFSPRL

PBAN(AS)+pSB1C3 This biobrick is the PBAN of Adoxophyes sp. on the pSB1C3 backbone.

PBAN Adoxophyes sp. 2 (BBa_K1415107)
HALFAS.png

Pcons(BBa_J23101) + RBS(BBa_B0034) + PBAN(AS) This circuit is responsible for producing the Adoxophyes sp.’s PBAN. As Adoxophyes sp.’s PBAN is ingested by the female Adoxophyes sp., the female Adoxophyes sp. will produce its own sex pheromone and attract male Adoxophyes sp.

PBAN Adoxophyes sp. 3 (BBa_K1415207)
ALLAS.png

Pcons(BBa_J23101) + RBS(BBa_B0034) + PBAN(AS) + RBS(BBa_B0034) + BFP(BBa_K592100)+ Ter(BBa_J61048) The above circuit is constructed mainly to test whether it produces Adoxophyes sp.’s PBAN. If the circuit do work, it would result in the expression of the BFP gene and the emission of blue fluorescent light.

PBAN Solenopsis invicta 1 (BBa_K1415008)
SI.png

Peptide Sequence: GSGEDLSYGDAYEVDEDDHPLFVPR

PBAN(SI)+pSB1C3 This biobrick is the PBAN of Solenopsis invicta on the pSB1C3 backbone.

PBAN Solenopsis invicta 2 (BBa_K1415108)
HALFSI.png

Pcons(BBa_J23101) + RBS(BBa_B0034) + PBAN(SI) This circuit is responsible for producing the Solenopsis invicta’s PBAN. As Solenopsis invicta’s PBAN is ingested by the female Solenopsis invicta, the female Solenopsis invicta will produce its own sex pheromone and attract male Solenopsis invictas.

PBAN Solenopsis invicta 3 (BBa_K1415208)
ALLSI.png

Pcons(BBa_J23101) + RBS(BBa_B0034) + PBAN(SI) + RBS(BBa_B0034) + BFP(BBa_K592100)+ Ter(BBa_J61048) The above circuit is constructed mainly to test whether it produces Solenopsis invicta PBAN. If the circuit do work, it would result in the expression of the BFP gene and the emission of blue fluorescent light.

PBAN Aedes aegypti 1 (BBa_K1415009)
AA.png

Peptide Sequence: DASSSNENNSRPPFAPRL

PBAN(AA)+pSB1C3 This biobrick is the PBAN of Aedes aegypti on the pSB1C3 backbone.

PBAN Aedes aegypti 2 (BBa_K1415109)
HALFAA.png

Pcons(BBa_J23101) + RBS(BBa_B0034) + PBAN(AA) This circuit is responsible for producing the Aedes aegypti’s PBAN. As Aedes aegypti’s PBAN is ingested by the female Aedes aegypti, the female Aedes aegypti will produce its own sex pheromone and attract male Aedes aegyptis.

PBAN Aedes aegypti 3 (BBa_K1415209)
ALLAA.png

Pcons(BBa_J23101) + RBS(BBa_B0034) + PBAN(AA) + RBS(BBa_B0034) + BFP(BBa_K592100)+ Ter(BBa_J61048) The above circuit is constructed mainly to test whether it produces Aedes aegypti’s PBAN. If the circuit do work, it would result in the expression of the BFP gene and the emission of blue fluorescent light.

Retrieved from "http://2014.igem.org/Team:NCTU_Formosa/biobricks"